PRGDB00047055 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186512053 (NM_118072)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT4G19520) mRNA, complete cds.

DNA Sequence

ATGGTCGACGGTAAGGAGGTTTACATCAGCTTTAATAGATGGGAGGATACGATACGGCACTCCTTTGTAAGCCATCTCTCTGCAGAGTTTCAACGCAAAGGCGTCTCTGTTTTCGCCAGTGAAGACTCAGCAAGCGATGATAGATTTGCGGAGGAGAGTGATGCAGCTATAGCGAAAGCAAGGGTTTCAGTGGTGATTTTCTCTGAGAATTTCGCTTCGTCCAAAGGATGCCTAAACGAGTTTTTGAAGGTTTCTAAGTGCCGACGTAGCAAGGGCCTAGTTGTGGTTCCAGTTTTCTACGGACTCACAAATTCCATAGTGAAGAAACATTGCTTGGAACTGAAAAAGATGTATCCTGACGATAAGGTAGACGAGTGGCGGAACGCTCTATGGGACATCGCAGACTTACGAGGAGGACACGTATCATCTCATAAGCGAAGCGACTCCGAACTTGTGGAAAAAATTGTTGCCGACGTGCGTCAAAAACTTGACCGTAGGGGTAGAATTGGAGTCTACTCCAGATTGACGAAGATAGAATACTTGCTTTGCAAGCAACCAGGCTGCATCATCCGCAGCTTAGGTATATGGGGTATGGCAGGCATAGGAAAGACGACACTTGCTAGAGCAGCTTATGACCAACTTTCCCGTGACTTTGAAGCTTCTTGCTTCATCGAAGACTTCGACAGGGAGTTTCAGGAGAAGGGCTTCTTTGGGTTGTTGGAGAAACAGCTTGGCGTAAACCCTCAAGTTACAAGACTGAGCATTCTTTTAAAAACATTACGCAGTAAAAGAATTCTTCTTGTTCTCGATGATGTGCGCAAGCCACTGGGTGCAACGAGTTTTCTTTGTGAATTTGACTGGCTTGGTCCTGGAAGCTTGATAATCGTAACCTCTCAAGATAAGCAAGTACTTGTCCAATGTCAGGTCAACGAGATATATAAGGTTCAAGGCTTAAACAAGCACGAGTCTCTGCAGCTGTTCTCCAGATGTGCGTTTGGAAAAGATGTACCAGATCAGAACCTCCTGGAGTTGTCTATGAAATTCGTTGACTATGCTAACGGAAACCCGTTAGCTCTCAGCATTTGTGGCAAGAATCTGAAGGGCAAAACACCTTTAGATATGAAGAGTGTAGTCCTTGAACTCAAGCGACATCTTTCCGACAAGATTTTCGTTAAACTTAAAAGCAGCTATGATGCACTTAGTGTCAGTGAGAAGGAAATCTTTCTGGACATTGTGTTTACCTTTAGGGGAGCAAATGTGGACAACGTAATGCAATCTCTTGCCGGTTGTGGATTCTTTCCACGAGTTGGAATCGAAGCTCTTGTGGACAAAAGTTTTGTAACTGTTTCAGAAAACAGAGTGCAAGTGAATAATTTGATCTACGATGTTGGCCTCAAAATCATCAATGATCAAAGCGATGAGATAGGGATGTGTTATAGATTCGTGGATGCTTCCAACAGTCAATCTCTTATAGAACATAAAGAAATCCGAGAATCAGAACAGGGCTATGAAGATGTTAAAGCCATAAACTTGGACACTTCTAACTTACCCTTCAAAGGTCATATCGCGTTTCAGCATATGTATAACCTAAGATATCTGACGATTTACAGCTCCATTAATCCTACGAAGGATCCTGACTTGTTCCTTCCAGGGGACCCTCAATTTCTGCCGCCTGAGCTAAGACTTCTCCACTGGACATGTTATCCTCTGCACTCTTTTCCACAAAACTTTGGTTTTCAGTATCTTGTGGAACTCAATATGCCCTGCAGTAAACTTAAGAAACTTTGGGGAGGAACCAAGAATCTTGAGGTCTTAAAGAGGATCACGCTCAGCTGTTCCGTGCAATTACTTAACGTTGATGAACTTCAATATTCTCCAAACATCGAAAAAATTGATCTCAAGGGATGTTTAGAGCTTCAAAGTTTTCCAGACACGGGTCAATTACAACATCTCCGTATTGTGGATCTCTCAACTTGCAAAAAGATAAAAAGTTTTCCAAAGGTGCCACCGTCTATTAGGAAACTGCATCTTCAGGGAACTGGCATAAGAGATCTATCCTCGTTGAATCATTCATCAGAAAGCCAAAGATTAACAAGGAAGTTGGAAAATGTTAGCTCTTCTAACCAAGATCACCGTAAGCAAGTCTTGAAGCTGAAAGATAGTTCTCATTTGGGAAGTCTGCCTGACATTGTTATTTTTGAGTCTCTTGAAGTTCTTGATTTTTCTGGTTGCTCAGAACTTGAAGATATTCAGGGTTTCCCCCAAAACCTGAAAAGGTTATATCTGGCTAAGACTGCCATAAAAGAAGTTCCATCATCGTTGTGCCACCATATCTCTAAACTTGTCAAACTAGATATGGAGAATTGCGAAAGGCTTCGAGACTTGCCGATGGGAATGAGTAACATGAAATATCTTGCCGTGCTGAAACTGTCTGGCTGCTCAAATCTTGAGAATATTAAGGAACTCCCAAGAAACCTTAAAGAGTTATATCTAGCCGGCACCGCGGTAAAGGAGTTCCCATCAACACTGCTTGAGACTCTCTCTGAAGTTGTTCTATTAGATTTGGAGAACTGCAAGAAGCTTCAGGGTCTGCCAACGGGAATGAGTAAATTGGAATTTCTTGTCATGCTCAAACTGTCTGGCTGCTCGAAGCTGGAAATTATTGTTGATCTTCCTCTAAATCTAATAGAGTTATATCTTGCTGGCACTGCCATCAGAGAATTGCCACCGTCTATTGGGGATCTAGCTCTACTTGATACATTAGATCTGAAGAACTGCAATAGACTCCGACACTTGCCAATGGAAATGCACAACTTGAATCCCCTCAAAGTTCTTGATCTATCAAACTGCTCAGAGCTTGAGGTATTCACAAGTTCTCTACCAAAAGTCAGAGAACTACGTCCAGCTCCTACAGTCATGCTACTTCGATCAAAGCTGCCATTTTGTTTCTTCATATTTTATGAACATAGAGTTACTTTGTCTCTTTATAAGGCACGTTTGCAGTATATTCCTGAAGAGATACGTTGGATGCCTTCACTAAAGACATTGGATCTTAGTAGGAACGGTTTCACAGAGGTGCCAGTAAGCATCAAGGATTTTTCTAAACTACTCAGTCTAAGGTTACGCTATTGCGAAAACCTCAGATCACTCCCACAGCTTCCCCGAAGTCTACAACTCTTGAATGCGCACGGTTGTTCATCACTGCAATTAATTACTCCGGACTTCAAGCAGCTTCCTAGGTATTACACGTTCAGTAATTGCTTTGGCCTACCCTCACACATGGTTAGCGAAGTTTTAGCGAATGCACCGGCTATTGTAGAATGCAGGAAACCACAGCAGGTCTTTCTCTTTCTATCTATCTATATCTCATATATAAGAACTGTACAATAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MVDGKEVYISFNRWEDTIRHSFVSHLSAEFQRKGVSVFASEDSASDDRFAEESDAAIAKARVSVVIFSENFASSKGCLNEFLKVSKCRRSKGLVVVPVFYGLTNSIVKKHCLELKKMYPDDKVDEWRNALWDIADLRGGHVSSHKRSDSELVEKIVADVRQKLDRRGRIGVYSRLTKIEYLLCKQPGCIIRSLGIWGMAGIGKTTLARAAYDQLSRDFEASCFIEDFDREFQEKGFFGLLEKQLGVNPQVTRLSILLKTLRSKRILLVLDDVRKPLGATSFLCEFDWLGPGSLIIVTSQDKQVLVQCQVNEIYKVQGLNKHESLQLFSRCAFGKDVPDQNLLELSMKFVDYANGNPLALSICGKNLKGKTPLDMKSVVLELKRHLSDKIFVKLKSSYDALSVSEKEIFLDIVFTFRGANVDNVMQSLAGCGFFPRVGIEALVDKSFVTVSENRVQVNNLIYDVGLKIINDQSDEIGMCYRFVDASNSQSLIEHKEIRESEQGYEDVKAINLDTSNLPFKGHIAFQHMYNLRYLTIYSSINPTKDPDLFLPGDPQFLPPELRLLHWTCYPLHSFPQNFGFQYLVELNMPCSKLKKLWGGTKNLEVLKRITLSCSVQLLNVDELQYSPNIEKIDLKGCLELQSFPDTGQLQHLRIVDLSTCKKIKSFPKVPPSIRKLHLQGTGIRDLSSLNHSSESQRLTRKLENVSSSNQDHRKQVLKLKDSSHLGSLPDIVIFESLEVLDFSGCSELEDIQGFPQNLKRLYLAKTAIKEVPSSLCHHISKLVKLDMENCERLRDLPMGMSNMKYLAVLKLSGCSNLENIKELPRNLKELYLAGTAVKEFPSTLLETLSEVVLLDLENCKKLQGLPTGMSKLEFLVMLKLSGCSKLEIIVDLPLNLIELYLAGTAIRELPPSIGDLALLDTLDLKNCNRLRHLPMEMHNLNPLKVLDLSNCSELEVFTSSLPKVRELRPAPTVMLLRSKLPFCFFIFYEHRVTLSLYKARLQYIPEEIRWMPSLKTLDLSRNGFTEVPVSIKDFSKLLSLRLRYCENLRSLPQLPRSLQLLNAHGCSSLQLITPDFKQLPRYYTFSNCFGLPSHMVSEVLANAPAIVECRKPQQVFLFLSIYISYIRTVQ

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
3-100 TIR
Toll/interleukin-1 receptor homology (TIR) domain

DGKEVYISFNRWEDTIRHSFVSHLSAEFQRKGVSVFASEDSASDDRFAEESDAAIAKARVSVVIFSENFASSKGCLNEFLKVSKCRRSKGLVVVPVFY

HMMSmart: SM00255
IPR000157
4-136 Toll
Toll/interleukin-1 receptor homology (TIR) domain

GKEVYISFNRWEDTIRHSFVSHLSAEFQRKGVSVFASEDSASDDRFAEESDAAIAKARVSVVIFSENFASSKGCLNEFLKVSKCRRSKGLVVVPVFYGLTNSIVKKHCLELKKMYPDDKVDEWRNALWDIADL

superfamily: SSF52200
IPR000157
7-138 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

VYISFNRWEDTIRHSFVSHLSAEFQRKGVSVFASEDSASDDRFAEESDAAIAKARVSVVIFSENFASSKGCLNEFLKVSKCRRSKGLVVVPVFYGLTNSIVKKHCLELKKMYPDDKVDEWRNALWDIADLRG

Gene3D: G3DSA:3.40.50.10140
7-128 no description

VYISFNRWEDTIRHSFVSHLSAEFQRKGVSVFASEDSASDDRFAEESDAAIAKARVSVVIFSENFASSKGCLNEFLKVSKCRRSKGLVVVPVFYGLTNSIVKKHCLELKKMYPDDKVDEWRN

HMMPfam: PF01582
IPR000157
7-116 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VYISFNRWEDTIRHSFVSHLSAEFQRKGVSVFASEDSASDDRFAEESDAAIAKARVSVVIFSENFASSKGCLNEFLKVSKCRRSKGLVVVPVFYGLTNSIVKKHCLELKK

HMMPanther: PTHR23155
17-1107 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TIRHSFVSHLSAEFQRKGVSVFASEDSASDDRFAEESDAAIAKARVSVVIFSENFASSKGCLNEFLKVSKCRRSKGLVVVPVFYGLTNSIVKKHCLELKKMYPDDKVDEWRNALWDIADLRGGHVSSHKRSDSELVEKIVADVRQKLDRRGRIGVYSRLTKIEYLLCKQPGCIIRSLGIWGMAGIGKTTLARAAYDQLSRDFEASCFIEDFDREFQEKGFFGLLEKQLGVNPQVTRLSILLKTLRSKRILLVLDDVRKPLGATSFLCEFDWLGPGSLIIVTSQDKQVLVQCQVNEIYKVQGLNKHESLQLFSRCAFGKDVPDQNLLELSMKFVDYANGNPLALSICGKNLKGKTPLDMKSVVLELKRHLSDKIFVKLKSSYDALSVSEKEIFLDIVFTFRGANVDNVMQSLAGCGFFPRVGIEALVDKSFVTVSENRVQVNNLIYDVGLKIINDQSDEIGMCYRFVDASNSQSLIEHKEIRESEQGYEDVKAINLDTSNLPFKGHIAFQHMYNLRYLTIYSSINPTKDPDLFLPGDPQFLPPELRLLHWTCYPLHSFPQNFGFQYLVELNMPCSKLKKLWGGTKNLEVLKRITLSCSVQLLNVDELQYSPNIEKIDLKGCLELQSFPDTGQLQHLRIVDLSTCKKIKSFPKVPPSIRKLHLQGTGIRDLSSLNHSSESQRLTRKLENVSSSNQDHRKQVLKLKDSSHLGSLPDIVIFESLEVLDFSGCSELEDIQGFPQNLKRLYLAKTAIKEVPSSLCHHISKLVKLDMENCERLRDLPMGMSNMKYLAVLKLSGCSNLENIKELPRNLKELYLAGTAVKEFPSTLLETLSEVVLLDLENCKKLQGLPTGMSKLEFLVMLKLSGCSKLEIIVDLPLNLIELYLAGTAIRELPPSIGDLALLDTLDLKNCNRLRHLPMEMHNLNPLKVLDLSNCSELEVFTSSLPKVRELRPAPTVMLLRSKLPFCFFIFYEHRVTLSLYKARLQYIPEEIRWMPSLKTLDLSRNGFTEVPVSIKDFSKLLSLRLRYCENLRSLPQLPRSLQLLNAHGCSSLQLITPDFKQLPRYYTFSNCFGLPSHMVSEVLANAPAIVE

HMMPanther: PTHR23155:SF286
17-1107 DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

TIRHSFVSHLSAEFQRKGVSVFASEDSASDDRFAEESDAAIAKARVSVVIFSENFASSKGCLNEFLKVSKCRRSKGLVVVPVFYGLTNSIVKKHCLELKKMYPDDKVDEWRNALWDIADLRGGHVSSHKRSDSELVEKIVADVRQKLDRRGRIGVYSRLTKIEYLLCKQPGCIIRSLGIWGMAGIGKTTLARAAYDQLSRDFEASCFIEDFDREFQEKGFFGLLEKQLGVNPQVTRLSILLKTLRSKRILLVLDDVRKPLGATSFLCEFDWLGPGSLIIVTSQDKQVLVQCQVNEIYKVQGLNKHESLQLFSRCAFGKDVPDQNLLELSMKFVDYANGNPLALSICGKNLKGKTPLDMKSVVLELKRHLSDKIFVKLKSSYDALSVSEKEIFLDIVFTFRGANVDNVMQSLAGCGFFPRVGIEALVDKSFVTVSENRVQVNNLIYDVGLKIINDQSDEIGMCYRFVDASNSQSLIEHKEIRESEQGYEDVKAINLDTSNLPFKGHIAFQHMYNLRYLTIYSSINPTKDPDLFLPGDPQFLPPELRLLHWTCYPLHSFPQNFGFQYLVELNMPCSKLKKLWGGTKNLEVLKRITLSCSVQLLNVDELQYSPNIEKIDLKGCLELQSFPDTGQLQHLRIVDLSTCKKIKSFPKVPPSIRKLHLQGTGIRDLSSLNHSSESQRLTRKLENVSSSNQDHRKQVLKLKDSSHLGSLPDIVIFESLEVLDFSGCSELEDIQGFPQNLKRLYLAKTAIKEVPSSLCHHISKLVKLDMENCERLRDLPMGMSNMKYLAVLKLSGCSNLENIKELPRNLKELYLAGTAVKEFPSTLLETLSEVVLLDLENCKKLQGLPTGMSKLEFLVMLKLSGCSKLEIIVDLPLNLIELYLAGTAIRELPPSIGDLALLDTLDLKNCNRLRHLPMEMHNLNPLKVLDLSNCSELEVFTSSLPKVRELRPAPTVMLLRSKLPFCFFIFYEHRVTLSLYKARLQYIPEEIRWMPSLKTLDLSRNGFTEVPVSIKDFSKLLSLRLRYCENLRSLPQLPRSLQLLNAHGCSSLQLITPDFKQLPRYYTFSNCFGLPSHMVSEVLANAPAIVE

Gene3D: G3DSA:3.40.50.300
183-299 no description

CKQPGCIIRSLGIWGMAGIGKTTLARAAYDQLSRDFEASCFIEDFDREFQEKGFFGLLEKQLGVNPQVTRLSILLKTLRSKRILLVLDDVRKPLGATSFLCEFDWLGPGSLIIVTSQ

superfamily: SSF52540
190-389 P-loop containing nucleoside triphosphate hydrolases

IRSLGIWGMAGIGKTTLARAAYDQLSRDFEASCFIEDFDREFQEKGFFGLLEKQLGVNPQVTRLSILLKTLRSKRILLVLDDVRKPLGATSFLCEFDWLGPGSLIIVTSQDKQVLVQCQVNEIYKVQGLNKHESLQLFSRCAFGKDVPDQNLLELSMKFVDYANGNPLALSICGKNLKGKTPLDMKSVVLELKRHLSDKI

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

SLGIWGMAGIGKTTLA

HMMPfam: PF00931
IPR002182
192-432 NB-ARC,NBS
NB-ARC

SLGIWGMAGIGKTTLARAAYDQLSRDFEASCFIEDFDREFQEKGFFGLLEKQLGVNPQVTRLSILLKTLRSKRILLVLDDVRKPLGATSFLCEFDWLGPGSLIIVTSQDKQVLVQCQVNEIYKVQGLNKHESLQLFSRCAFGKDVPDQNLLELSMKFVDYANGNPLALSICGKNLKGKTPLDMKSVVLELKRHLSDKIFVKLKSSYDALSVSEKEIFLDIVFTFRGANVDNVMQSLAGCGF

FPrintScan: PR00364
IPR000767
259-273 DISEASERSIST
Disease resistance protein

TLRSKRILLVLDDVR

FPrintScan: PR00364
IPR000767
352-366 DISEASERSIST
Disease resistance protein

ANGNPLALSICGKNL

Gene3D: G3DSA:3.80.10.10
498-677 no description

ESEQGYEDVKAINLDTSNLPFKGHIAFQHMYNLRYLTIYSSINPTKDPDLFLPGDPQFLPPELRLLHWTCYPLHSFPQNFGFQYLVELNMPCSKLKKLWGGTKNLEVLKRITLSCSVQLLNVDELQYSPNIEKIDLKGCLELQSFPDTGQLQHLRIVDLSTCKKIKSFPKVPPSIRKLHL

superfamily: SSF52058
549-820 L domain-like,LRR

LPGDPQFLPPELRLLHWTCYPLHSFPQNFGFQYLVELNMPCSKLKKLWGGTKNLEVLKRITLSCSVQLLNVDELQYSPNIEKIDLKGCLELQSFPDTGQLQHLRIVDLSTCKKIKSFPKVPPSIRKLHLQGTGIRDLSSLNHSSESQRLTRKLENVSSSNQDHRKQVLKLKDSSHLGSLPDIVIFESLEVLDFSGCSELEDIQGFPQNLKRLYLAKTAIKEVPSSLCHHISKLVKLDMENCERLRDLPMGMSNMKYLAVLKLSGCSNLENIK

HMMPfam: PF07725
IPR011713
581-600 LRR_3
Leucine-rich repeat 3

YLVELNMPCSKLKKLWGGTK

Gene3D: G3DSA:3.80.10.10
678-965 no description

QGTGIRDLSSLNHSSESQRLTRKLENVSSSNQDHRKQVLKLKDSSHLGSLPDIVIFESLEVLDFSGCSELEDIQGFPQNLKRLYLAKTAIKEVPSSLCHHISKLVKLDMENCERLRDLPMGMSNMKYLAVLKLSGCSNLENIKELPRNLKELYLAGTAVKEFPSTLLETLSEVVLLDLENCKKLQGLPTGMSKLEFLVMLKLSGCSKLEIIVDLPLNLIELYLAGTAIRELPPSIGDLALLDTLDLKNCNRLRHLPMEMHNLNPLKVLDLSNCSELEVFTSSLPKVRE

Coil: coil
694-715 coiled-coil

SQRLTRKLENVSSSNQDHRKQV

superfamily: SSF52058
753-1085 L domain-like,LRR

FPQNLKRLYLAKTAIKEVPSSLCHHISKLVKLDMENCERLRDLPMGMSNMKYLAVLKLSGCSNLENIKELPRNLKELYLAGTAVKEFPSTLLETLSEVVLLDLENCKKLQGLPTGMSKLEFLVMLKLSGCSKLEIIVDLPLNLIELYLAGTAIRELPPSIGDLALLDTLDLKNCNRLRHLPMEMHNLNPLKVLDLSNCSELEVFTSSLPKVRELRPAPTVMLLRSKLPFCFFIFYEHRVTLSLYKARLQYIPEEIRWMPSLKTLDLSRNGFTEVPVSIKDFSKLLSLRLRYCENLRSLPQLPRSLQLLNAHGCSSLQLITPDFKQLPRYYTFS

Seg: seg
841-853 seg

STLLETLSEVVLL

FPrintScan: PR00364
IPR000767
937-953 DISEASERSIST
Disease resistance protein

HNLNPLKVLDLSNCSEL

HMMPfam: PF13504
942-954 LRR_7,Leucine rich repeat

LKVLDLSNCSELE

Gene3D: G3DSA:3.80.10.10
989-1079 no description

HRVTLSLYKARLQYIPEEIRWMPSLKTLDLSRNGFTEVPVSIKDFSKLLSLRLRYCENLRSLPQLPRSLQLLNAHGCSSLQLITPDFKQLP

HMMPfam: PF00560
IPR001611
1012-1031 LRR_1
Leucine-rich repeat

SLKTLDLSRNGFTEVPVSIK

Seg: seg
1046-1061 seg

NLRSLPQLPRSLQLLN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox