PRGDB00047056 (disease resistance protein (TIR-NBS class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145338096 (NM_111292)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS class), putative (AT3G04210) mRNA, complete cds.

DNA Sequence

ATGGATTCTTATTTTTTCCTTGGCACTGTTGTTGTTGTTGCTCTTGCAATCTACACGCTTTTGGGAACAATATCTTTTATGGTTTATAGAAAATTCAGGTTACACCAAGAGAAGAACAACATATCATCTTGTTTTTCTTTTTCATCTTGCTTTTCTTTTTCATCTTCTTCATCGACTTCGTCGCCCGGTCGTAAACACCAAGTCTTTCCAAGTTTCCACGGGGCAGATGTACGCAAATCCTTTCTCAGCCACATCATGAAGGAGTTCAAAAGCAAGGGAATCGACATATTCATTGATAAAGATATCAAGAGGGGTAAGTCCATCGGTCCTGAGCTCACAGAAGCTATCAGAGGATCGAGGGTTGCGATTGTCTTCCTCTCGAGGAAATATGCTTCTTCGTCGTGGTGCCTGAATGAGTTGGCACTGATCATGAAGTGCAGAAAAGAGTTGGGTCTAACAGTGATGACCCTTTTCTATGACTTGGACCCAACTGATGTAAGGAAGCAGACCGGAGATTTTGGGATGGCCTTCAAAGAAACTTGTAAAGGTAAAACAAAGGATGAAATTGGAAGATGGAGACATGCTTTGGAGGAAGTCGCCAAAATCGCCGGTTACCATTCAAGCATATGGGATAATGAAGCGGACATGATCGGAATAGTCACCACTGATATTTCAAATACGTTGAACATCTCAACGCCGTCAAGTGATTTCAGCGACTTAGTTGGGATGGAGGATCATATGAAAAAATTGGAACGAATGTTATACCTAGATCTGAATGATGTGAGGATGATAGGGATTTGGGGTCCTCCTGGGATTGGTAAGACTTCCATCGCCAGAGTTTTATTTCGAAAACATTCTGACAGTTTCGATTTGAGTGTCTTTATGGAGACTGTCAAGGGTTATACAAGACCAGGTTGTTCGGATGAACACGGTCTTAAGCTGCACTTACAGCAGCAGTTTCTGTCTCAAATATTCAACCAGAAGGATGTAGAAGTTCCTCACTTAGGAGTTGTACAAGACAGGTTAAGAGACAAGAGAGTGCTTGTTGTGCTTGATGACGTTGATCAGTCAGCACAATTAGAAGCCATGGCCAAGGAAAATAAGTGGTTTGGTCCTGGAAGTCGGATTATCATCACCACGCAAGATCGAAGACTTTTGAAAGCACATGGAATCAAAGATGTGTACAAGGTGGATTTACCACCACCTGATGATGCTTTTCAAATCTTCTGCATGTATGCTTTTGGTAAAACCTCTCCAAAACATGGTTTCGAGGAGCTTGCATGGGAAGCTACATACCTTTCTGGTATACACCCTTCGGGAATAAAAAGTATGGGCTCTTATTTCCGGAAAATGTCAAAACCGGAGTGGGTAAACGCGTTACAAAGGTTAAGGACTAGTAAGCTTGACTCTGAATCTCCGAGGACCCACAGAAAGCTCATAAATAGATTAAGGAATGTAAAACAGAAGATGCTGTCAAATACGTTGAGCCGTATAAGGAAGCACCAAATAGCATCAGCAGCAGCAAAAGCTGCTAGTGTTTATGAAACAAGTATAAAAGAAGAGGTGGATTCGTCCGCGGAGTCGTTGAATCATTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS class), putative disease resistance protein (TIR-NBS class), putative [Arabidopsis thaliana].

MDSYFFLGTVVVVALAIYTLLGTISFMVYRKFRLHQEKNNISSCFSFSSCFSFSSSSSTSSPGRKHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKIAGYHSSIWDNEADMIGIVTTDISNTLNISTPSSDFSDLVGMEDHMKKLERMLYLDLNDVRMIGIWGPPGIGKTSIARVLFRKHSDSFDLSVFMETVKGYTRPGCSDEHGLKLHLQQQFLSQIFNQKDVEVPHLGVVQDRLRDKRVLVVLDDVDQSAQLEAMAKENKWFGPGSRIIITTQDRRLLKAHGIKDVYKVDLPPPDDAFQIFCMYAFGKTSPKHGFEELAWEATYLSGIHPSGIKSMGSYFRKMSKPEWVNALQRLRTSKLDSESPRTHRKLINRLRNVKQKMLSNTLSRIRKHQIASAAAKAASVYETSIKEEVDSSAESLNH

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
54-205 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSSSTSSPGRKHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKIAGY

Gene3D: G3DSA:3.40.50.10140
63-201 G3DSA:3.40.50.10140

GRKHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAK

ProfileScan: PS50104
IPR000157
64-202 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RKHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKI

HMMSmart: SM00255
IPR000157
65-202 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKI

HMMPfam: PF01582
IPR000157
68-197 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALE

HMMPanther: PTHR23155:SF296
76-376 PTHR23155:SF296

DVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKIAGYHSSIWDNEADMIGIVTTDISNTLNISTPSSDFSDLVGMEDHMKKLERMLYLDLNDVRMIGIWGPPGIGKTSIARVLFRKHSDSFDLSVFMETVKGYTRPGCSDEHGLKLHLQQQFLSQIFNQKDVEVPHLGVVQDRLRDKRVLVVLDDVDQSAQLEAMAKENKWFGPGSRI

HMMPanther: PTHR23155
76-376 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKSFLSHIMKEFKSKGIDIFIDKDIKRGKSIGPELTEAIRGSRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKIAGYHSSIWDNEADMIGIVTTDISNTLNISTPSSDFSDLVGMEDHMKKLERMLYLDLNDVRMIGIWGPPGIGKTSIARVLFRKHSDSFDLSVFMETVKGYTRPGCSDEHGLKLHLQQQFLSQIFNQKDVEVPHLGVVQDRLRDKRVLVVLDDVDQSAQLEAMAKENKWFGPGSRI

superfamily: SSF52540
119-466 SSF52540

SRVAIVFLSRKYASSSWCLNELALIMKCRKELGLTVMTLFYDLDPTDVRKQTGDFGMAFKETCKGKTKDEIGRWRHALEEVAKIAGYHSSIWDNEADMIGIVTTDISNTLNISTPSSDFSDLVGMEDHMKKLERMLYLDLNDVRMIGIWGPPGIGKTSIARVLFRKHSDSFDLSVFMETVKGYTRPGCSDEHGLKLHLQQQFLSQIFNQKDVEVPHLGVVQDRLRDKRVLVVLDDVDQSAQLEAMAKENKWFGPGSRIIITTQDRRLLKAHGIKDVYKVDLPPPDDAFQIFCMYAFGKTSPKHGFEELAWEATYLSGIHPSGIKSMGSYFRKMSKPEWVNALQRLRTS

Gene3D: G3DSA:3.40.50.300
234-272 G3DSA:3.40.50.300

SSDFSDLVGMEDHMKKLERMLYLDLNDVRMIGIWGPPGI

HMMPfam: PF00931
IPR002182
244-472 NB-ARC,NBS
NB-ARC

EDHMKKLERMLYLDLNDVRMIGIWGPPGIGKTSIARVLFRKHSDSFDLSVFMETVKGYTRPGCSDEHGLKLHLQQQFLSQIFNQKDVEVPHLGVVQDRLRDKRVLVVLDDVDQSAQLEAMAKENKWFGPGSRIIITTQDRRLLKAHGIKDVYKVDLPPPDDAFQIFCMYAFGKTSPKHGFEELAWEATYLSGIHPSGIKSMGSYFRKMSKPEWVNALQRLRTSKLDSES

FPrintScan: PR00364
IPR000767
263-278 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTSIA

Gene3D: G3DSA:3.40.50.300
273-291 G3DSA:3.40.50.300

GKTSIARVLFRKHSDSFDL

Gene3D: G3DSA:3.40.50.300
317-383 G3DSA:3.40.50.300

QQQFLSQIFNQKDVEVPHLGVVQDRLRDKRVLVVLDDVDQSAQLEAMAKENKWFGPGSRIIITTQDR

FPrintScan: PR00364
IPR000767
341-355 DISEASERSIST
Disease resistance protein

RLRDKRVLVVLDDVD

Gene3D: G3DSA:3.40.50.300
429-448 G3DSA:3.40.50.300

EATYLSGIHPSGIKSMGSYF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox