PRGDB00047057 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 79539441 (NM_125197)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G58120) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCGTCTTCTTCTTCTCGGTCTCGCACCTGGAGATACCGCGTCTTCACGAACTTCCATGGACCTGACGTCCGTAAAACATTCCTCAGCCATTTACGTAAACAGTTTAGCTACAACGGGATTTCGATGTTTAATGATCAAAGTATCGAAAGAAGCCAAACCATCGTCCCTGCTCTCACAGGAGCAATCAAGGAATCGAGGATCTCGATCGTGGTGCTCTCGAAGAACTACGCATCATCGAGGTGGTGTTTGGATGAGCTGCTAGAGATTTTGAAGTGCAGGGAAGATATAGGACAAATAGTGATGACCGTCTTTTACGGAGTAGATCCATCTGATGTCCGTAAACAGACCGGAGAATTTGGGATCGCTTTTAATAAAACTTGTGAAGGGAAGACAAATGAGGAGACACAAAAATGGAGCAAAGCTTTGAACGATGTTGGAAACATTGCTGGAGAGCACTTCTTTAACTGGGATAATGAAGCGAAGATGATTGAGAAGATTGCAAGAGATGTTTCGAACAAACTAAACGCCACAATCTCTTGGGATTTTGAAGACATGGTGGGTATTGAAGCACATTTGCAGAAAATGCAGTCTTTGTTACATTTAGATTATGAGGATGGAGCTATGATTGTAGGAATCTATGGTCCTGCAGGTATTGGTAAGACTACCATTGCCAGAGCTTTACATAGCCGACTCTCTAGCAGTTTTCAGCTTACTTGTTTTATGGAGAATATTAGGGGAAGCTATAATAGTGGTCTTGACGAGTATGGTTTGAAGCTGCGATTACAAGAACAACTTCTTTCCAAAGTTCTAAACCATGATGGTATAAGGATAAACCATTTAGGTGCGATTCCAGAAAGGCTATGTGACCAAAAAGTTCTTATCATTCTTGATGATGTGGACGATTTGCAGCAACTTGAGGCTTTGGCTAATGAAACTAACTGGTTTGGTCCTGGAAGCAGGATTATTGTGACCACGGAGGATCAAGAGCTTTTGGAGCAACATGATGTTAACAAAAAATATCATGTTGATTTTCCAACTAGAGAAGAAGCTTGTAAAATCTTTTGTACATATGCTTTCAGACGGAGCTTTGCACCATATGGTTTTGAAAAGCTTGCTGAAAGAGTAACATGGCTTTGTAGCAACCTTCCTCTAGGTCTCCGTGTCATGGGTTCAACTTTACGCGGAAAGAAAGAAGATGACTGGGAAGGTATATTGCGTAGGCTAGAAAATAGCCTTGATCGAAAGATCGATGGAGTTCTTAGAGTCGGATACGACCATTTATGTGAGGACGATCAGTTTCTATATCTCCTCATTGCATTCTTCTTCAACTACGTCGACGATGATCATGTGAAAGCAATGCTCGTTGAAGATAATTTGGATGTCAAACTCGGGTTGAAAACGCTTGCGTATAAATCTCTCATTCAAATATCGGCGGAAGGGAATATAGTGATGCACAAGTTACTACAACGAGTGGGTAGAGAAGCTATTCAAAGACAAGAGCCCACGAAACGGAGAATCTTGATTGATGCTCGTGAGATTTGCGATGTCCTTCGATATGGGAAAGGTACTAGTAATGTGTCTGGCATATCATTTGATACATCAGATATGAGTGAAGTGACTATAAGTGATGACGCTTTTAAAAGACTGCATGATCTTCGATTCCTCAAAGTTACCAAAAGTAGATATGATGGGAAATATAGAATGCATATACCTGCGGGGATAGAGTTTCCTTGTCTTCTAAGGTTACTACATTGGGAGGCATATCCAAGCAAGTGTCTTCCTCCTACATTTAATCCAGAATTTCTTGTGGAACTCAATATGCAGGGAAGCCAGCTCGAGCACCTCTGGAGTGGAACTCAGTCGCTTAGAAATCTCAAGAATATGGATTTGGGATGGTCCCCGAATTTGAAGGAACTCCCGGATCTTACAAATGCTACAAATCTGGAGGATTTGAATCTAAATAGTTGCGAGAGTTTGGTAGAGATTCCATCCTCTTTTTCGCATCTTCATAAACTAAAGAACTTGTGGATGAGTTACTGCATAAACCTACAAGTCATTCCTGCTCACATGAACTTGGTATCCCTAGAACGCGTCACTATGACAGGATGCTCAAGATTCAGAAAAATTCCAGTAATTTCAACGCACATCAATTATCTGGATATAGCACACAACACGGAGTTCGAAGTTGTGCATGCATCAATTGCTTTGTGGTGTCGTCTCCACTATCTCAATATGAGCTACAATGAAAATTTCATGGGATTAACGCACCTCCCCATGTCTTTAACACAACTCATCCTAAGATATTCCGATATTGAAAGGATTCCTGATTGCATCAAAGCTCTTCATCAGCTGTTTTCACTTGATCTAACTGGCTGCAGAAGACTTGCATCATTGCCAGAGCTCCCTGGTTCGCTCCTTGATCTAGAGGCAGAAGATTGTGAATCACTGGAGACCGTATTTAGCCCTTTACACACGCCAAGAGCGCTCCTCAATTTCACCAACTGCTTCAAATTGGGTGGCCAAGCACGGAGAGCAATTATCCGACGACGATCAGAAATTATCGGGAAGGCTCTCTTACCAGGAAGAGAAGTGCCTGCAGAGTTTGATCACAGAGCTAAAGGTAATTCCTTGACCATTATTCTCAATGGTTACAGGCCTTCTTATGACTTCATCCAATATTTGGTCTGCGTTGTGATTTCCCCTAACCAAGAAATCACAAAAATAAGTGATTCTTCCACCCTATTATGTCACACGAACGGCTACATATTCCCATCTTATGAGGAGGTGTACATAGGCGCTGTCTCAAAATGTCGAAAGGAACATCTATTTATATTTCGCTCTGGCTATTATCTAAACGTCGACCCCTCTGGAGCAAGCAGAGAGATTGTGTTCGAATTCAGCAGCAAATCGCAAGACTTCGACATTATTGAATGTGGTGTCAAGATCTGGACCGCACAAAGCATCGAACGGGGTTACCTAGTGTTTGAAGACGACAATGAGATTAAACACGATGACCATACAAATAGAGTTAGGGGACACTACAAAGCATCAAACGTGGACTACAAGTCTGTATCCAGGAAGCGTCCGAGGAAGACAGATCTGAAGTTGGAAATCCCAAGACGACGTTTTTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSSSSRSRTWRYRVFTNFHGPDVRKTFLSHLRKQFSYNGISMFNDQSIERSQTIVPALTGAIKESRISIVVLSKNYASSRWCLDELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGIAFNKTCEGKTNEETQKWSKALNDVGNIAGEHFFNWDNEAKMIEKIARDVSNKLNATISWDFEDMVGIEAHLQKMQSLLHLDYEDGAMIVGIYGPAGIGKTTIARALHSRLSSSFQLTCFMENIRGSYNSGLDEYGLKLRLQEQLLSKVLNHDGIRINHLGAIPERLCDQKVLIILDDVDDLQQLEALANETNWFGPGSRIIVTTEDQELLEQHDVNKKYHVDFPTREEACKIFCTYAFRRSFAPYGFEKLAERVTWLCSNLPLGLRVMGSTLRGKKEDDWEGILRRLENSLDRKIDGVLRVGYDHLCEDDQFLYLLIAFFFNYVDDDHVKAMLVEDNLDVKLGLKTLAYKSLIQISAEGNIVMHKLLQRVGREAIQRQEPTKRRILIDAREICDVLRYGKGTSNVSGISFDTSDMSEVTISDDAFKRLHDLRFLKVTKSRYDGKYRMHIPAGIEFPCLLRLLHWEAYPSKCLPPTFNPEFLVELNMQGSQLEHLWSGTQSLRNLKNMDLGWSPNLKELPDLTNATNLEDLNLNSCESLVEIPSSFSHLHKLKNLWMSYCINLQVIPAHMNLVSLERVTMTGCSRFRKIPVISTHINYLDIAHNTEFEVVHASIALWCRLHYLNMSYNENFMGLTHLPMSLTQLILRYSDIERIPDCIKALHQLFSLDLTGCRRLASLPELPGSLLDLEAEDCESLETVFSPLHTPRALLNFTNCFKLGGQARRAIIRRRSEIIGKALLPGREVPAEFDHRAKGNSLTIILNGYRPSYDFIQYLVCVVISPNQEITKISDSSTLLCHTNGYIFPSYEEVYIGAVSKCRKEHLFIFRSGYYLNVDPSGASREIVFEFSSKSQDFDIIECGVKIWTAQSIERGYLVFEDDNEIKHDDHTNRVRGHYKASNVDYKSVSRKRPRKTDLKLEIPRRRF

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-154 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSSSSRSRTWRYRVFTNFHGPDVRKTFLSHLRKQFSYNGISMFNDQSIERSQTIVPALTGAIKESRISIVVLSKNYASSRWCLDELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGIAFNKTCEGKTNEETQKWSKALNDVGNIAGE

Gene3D: G3DSA:3.40.50.10140
11-148 G3DSA:3.40.50.10140

RTWRYRVFTNFHGPDVRKTFLSHLRKQFSYNGISMFNDQSIERSQTIVPALTGAIKESRISIVVLSKNYASSRWCLDELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGIAFNKTCEGKTNEETQKWSKALNDV

ProfileScan: PS50104
IPR000157
13-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WRYRVFTNFHGPDVRKTFLSHLRKQFSYNGISMFNDQSIERSQTIVPALTGAIKESRISIVVLSKNYASSRWCLDELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGIAFNKTCEGKTNEETQKWSKALNDVGNI

HMMSmart: SM00255
IPR000157
14-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYRVFTNFHGPDVRKTFLSHLRKQFSYNGISMFNDQSIERSQTIVPALTGAIKESRISIVVLSKNYASSRWCLDELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGIAFNKTCEGKTNEETQKWSKALNDVGNI

HMMPfam: PF01582
IPR000157
17-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFTNFHGPDVRKTFLSHLRKQFSYNGISMFNDQSIERSQTIVPALTGAIKESRISIVVLSKNYASSRWCLDELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGIAFNKTCEGKTNEETQKWSKALN

HMMPanther: PTHR11017:SF20
38-1021 PTHR11017:SF20,SUBFAMILY NOT NAMED

FSYNGISMFNDQSIERSQTIVPALTGAIKESRISIVVLSKNYASSRWCLDELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGIAFNKTCEGKTNEETQKWSKALNDVGNIAGEHFFNWDNEAKMIEKIARDVSNKLNATISWDFEDMVGIEAHLQKMQSLLHLDYEDGAMIVGIYGPAGIGKTTIARALHSRLSSSFQLTCFMENIRGSYNSGLDEYGLKLRLQEQLLSKVLNHDGIRINHLGAIPERLCDQKVLIILDDVDDLQQLEALANETNWFGPGSRIIVTTEDQELLEQHDVNKKYHVDFPTREEACKIFCTYAFRRSFAPYGFEKLAERVTWLCSNLPLGLRVMGSTLRGKKEDDWEGILRRLENSLDRKIDGVLRVGYDHLCEDDQFLYLLIAFFFNYVDDDHVKAMLVEDNLDVKLGLKTLAYKSLIQISAEGNIVMHKLLQRVGREAIQRQEPTKRRILIDAREICDVLRYGKGTSNVSGISFDTSDMSEVTISDDAFKRLHDLRFLKVTKSRYDGKYRMHIPAGIEFPCLLRLLHWEAYPSKCLPPTFNPEFLVELNMQGSQLEHLWSGTQSLRNLKNMDLGWSPNLKELPDLTNATNLEDLNLNSCESLVEIPSSFSHLHKLKNLWMSYCINLQVIPAHMNLVSLERVTMTGCSRFRKIPVISTHINYLDIAHNTEFEVVHASIALWCRLHYLNMSYNENFMGLTHLPMSLTQLILRYSDIERIPDCIKALHQLFSLDLTGCRRLASLPELPGSLLDLEAEDCESLETVFSPLHTPRALLNFTNCFKLGGQARRAIIRRRSEIIGKALLPGREVPAEFDHRAKGNSLTIILNGYRPSYDFIQYLVCVVISPNQEITKISDSSTLLCHTNGYIFPSYEEVYIGAVSKCRKEHLFIFRSGYYLNVDPSGASREIVFEFSSKSQDFDIIECGVKIWTAQSIERGYLVFEDDNEIKHDDHTNRVRGHYKASN

HMMPanther: PTHR11017
38-1021 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FSYNGISMFNDQSIERSQTIVPALTGAIKESRISIVVLSKNYASSRWCLDELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGIAFNKTCEGKTNEETQKWSKALNDVGNIAGEHFFNWDNEAKMIEKIARDVSNKLNATISWDFEDMVGIEAHLQKMQSLLHLDYEDGAMIVGIYGPAGIGKTTIARALHSRLSSSFQLTCFMENIRGSYNSGLDEYGLKLRLQEQLLSKVLNHDGIRINHLGAIPERLCDQKVLIILDDVDDLQQLEALANETNWFGPGSRIIVTTEDQELLEQHDVNKKYHVDFPTREEACKIFCTYAFRRSFAPYGFEKLAERVTWLCSNLPLGLRVMGSTLRGKKEDDWEGILRRLENSLDRKIDGVLRVGYDHLCEDDQFLYLLIAFFFNYVDDDHVKAMLVEDNLDVKLGLKTLAYKSLIQISAEGNIVMHKLLQRVGREAIQRQEPTKRRILIDAREICDVLRYGKGTSNVSGISFDTSDMSEVTISDDAFKRLHDLRFLKVTKSRYDGKYRMHIPAGIEFPCLLRLLHWEAYPSKCLPPTFNPEFLVELNMQGSQLEHLWSGTQSLRNLKNMDLGWSPNLKELPDLTNATNLEDLNLNSCESLVEIPSSFSHLHKLKNLWMSYCINLQVIPAHMNLVSLERVTMTGCSRFRKIPVISTHINYLDIAHNTEFEVVHASIALWCRLHYLNMSYNENFMGLTHLPMSLTQLILRYSDIERIPDCIKALHQLFSLDLTGCRRLASLPELPGSLLDLEAEDCESLETVFSPLHTPRALLNFTNCFKLGGQARRAIIRRRSEIIGKALLPGREVPAEFDHRAKGNSLTIILNGYRPSYDFIQYLVCVVISPNQEITKISDSSTLLCHTNGYIFPSYEEVYIGAVSKCRKEHLFIFRSGYYLNVDPSGASREIVFEFSSKSQDFDIIECGVKIWTAQSIERGYLVFEDDNEIKHDDHTNRVRGHYKASN

superfamily: SSF52540
68-435 SSF52540

SRISIVVLSKNYASSRWCLDELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGIAFNKTCEGKTNEETQKWSKALNDVGNIAGEHFFNWDNEAKMIEKIARDVSNKLNATISWDFEDMVGIEAHLQKMQSLLHLDYEDGAMIVGIYGPAGIGKTTIARALHSRLSSSFQLTCFMENIRGSYNSGLDEYGLKLRLQEQLLSKVLNHDGIRINHLGAIPERLCDQKVLIILDDVDDLQQLEALANETNWFGPGSRIIVTTEDQELLEQHDVNKKYHVDFPTREEACKIFCTYAFRRSFAPYGFEKLAERVTWLCSNLPLGLRVMGSTLRGKKEDDWEGILRRLENSLDRKIDGVLRVGYDHLCEDDQ

Gene3D: G3DSA:3.40.50.300
184-338 G3DSA:3.40.50.300

DFEDMVGIEAHLQKMQSLLHLDYEDGAMIVGIYGPAGIGKTTIARALHSRLSSSFQLTCFMENIRGSYNSGLDEYGLKLRLQEQLLSKVLNHDGIRINHLGAIPERLCDQKVLIILDDVDDLQQLEALANETNWFGPGSRIIVTTEDQELLEQHD

HMMPfam: PF00931
IPR002182
192-449 NB-ARC,NBS
NB-ARC

EAHLQKMQSLLHLDYEDGAMIVGIYGPAGIGKTTIARALHSRLSSSFQLTCFMENIRGSYNSGLDEYGLKLRLQEQLLSKVLNHDGIRINHLGAIPERLCDQKVLIILDDVDDLQQLEALANETNWFGPGSRIIVTTEDQELLEQHDVNKKYHVDFPTREEACKIFCTYAFRRSFAPYGFEKLAERVTWLCSNLPLGLRVMGSTLRGKKEDDWEGILRRLENSLDRKIDGVLRVGYDHLCEDDQFLYLLIAFFFNYVD

HMMSmart: SM00382
IPR003593
209-351 AAA,NBS
AAA+ ATPase domain

GAMIVGIYGPAGIGKTTIARALHSRLSSSFQLTCFMENIRGSYNSGLDEYGLKLRLQEQLLSKVLNHDGIRINHLGAIPERLCDQKVLIILDDVDDLQQLEALANETNWFGPGSRIIVTTEDQELLEQHDVNKKYHVDFPTRE

FPrintScan: PR00364
IPR000767
212-227 DISEASERSIST
Disease resistance protein

IVGIYGPAGIGKTTIA

FPrintScan: PR00364
IPR000767
289-303 DISEASERSIST
Disease resistance protein

RLCDQKVLIILDDVD

FPrintScan: PR00364
IPR000767
382-396 DISEASERSIST
Disease resistance protein

CSNLPLGLRVMGSTL

superfamily: SSF46785
417-521 SSF46785

RKIDGVLRVGYDHLCEDDQFLYLLIAFFFNYVDDDHVKAMLVEDNLDVKLGLKTLAYKSLIQISAEGNIVMHKLLQRVGREAIQRQEPTKRRILIDAREICDVLR

superfamily: SSF52058
505-841 SSF52058,LRR

TKRRILIDAREICDVLRYGKGTSNVSGISFDTSDMSEVTISDDAFKRLHDLRFLKVTKSRYDGKYRMHIPAGIEFPCLLRLLHWEAYPSKCLPPTFNPEFLVELNMQGSQLEHLWSGTQSLRNLKNMDLGWSPNLKELPDLTNATNLEDLNLNSCESLVEIPSSFSHLHKLKNLWMSYCINLQVIPAHMNLVSLERVTMTGCSRFRKIPVISTHINYLDIAHNTEFEVVHASIALWCRLHYLNMSYNENFMGLTHLPMSLTQLILRYSDIERIPDCIKALHQLFSLDLTGCRRLASLPELPGSLLDLEAEDCESLETVFSPLHTPRALLNFTNCFKL

Gene3D: G3DSA:3.80.10.10
533-817 G3DSA:3.80.10.10

SFDTSDMSEVTISDDAFKRLHDLRFLKVTKSRYDGKYRMHIPAGIEFPCLLRLLHWEAYPSKCLPPTFNPEFLVELNMQGSQLEHLWSGTQSLRNLKNMDLGWSPNLKELPDLTNATNLEDLNLNSCESLVEIPSSFSHLHKLKNLWMSYCINLQVIPAHMNLVSLERVTMTGCSRFRKIPVISTHINYLDIAHNTEFEVVHASIALWCRLHYLNMSYNENFMGLTHLPMSLTQLILRYSDIERIPDCIKALHQLFSLDLTGCRRLASLPELPGSLLDLEAEDCE

HMMPfam: PF07725
IPR011713
604-623 LRR_3
Leucine-rich repeat 3

FLVELNMQGSQLEHLWSGTQ

HMMPfam: PF00560
IPR001611
650-672 LRR_1
Leucine-rich repeat

NLEDLNLNSCESLVEIPSSFSHL

FPrintScan: PR00364
IPR000767
782-798 DISEASERSIST
Disease resistance protein

KALHQLFSLDLTGCRRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox