PRGDB00047058 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30693545 (NM_123373)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G40100) mRNA, complete cds.

DNA Sequence

ATGGCTTCCTCATCCGCATCTCGTGCATCCAGCTATGATGTCTTCTTAAGTTTCCGTGGGGAAGACACTCGACATTCTATCGTCAGCCATTTGTACGAAGCACTTACCAGCAGAGGAATTGCTACCTTCAAAGACGACAAAAGGCTTGAGCTAGGTGATCACATTTCTGAAGAACTCCAAAGAGCCATTGAGGGTTCAGATTTTGTTGTCGTGGTTCTCTCAGAGAACTACCCTACTTCTAGGTGGTGCTTAATGGAGCTCCAATCGATAATGGAGCTTCAGATGGAGGGAAGACTTGGTGTCTTTCCCGTCTTCTACAGAGTAGAACCCTCTGCAGTGAGGTATCAGCTAGGAAGTTTCGATCTAGAAGGGTACCAACGTGATCCACAAATGGCTGATATGGTTCCCAAGTGGAGACAAGCTCTTAAACTGATTGCCGATCTTTCAGGCGTGGCATCGGGACAATGCATTGATGAGGCAACTATGGTTCGGAAAATTGTCGAAGATATTTCAAAGCGCAAGACATTGAAGCATAAGATAGATTTCAGAAATTTTGTTGGTGTGGATACTCACCTGCAAGGTCTCAAGTCGCTCTTGGACATGGACTCCAATAATGATGAGGTTCGTATGATTGGAATATGGGGAATGGGAGGCATTGGAAAAACCACCATCGCCAAGTGTCTCTATGACCAGCTCTCATCACAATTTACAGCTAGTTATTTCACACAAGACATTAAAGGTATTCATAAAGAGCTTGATCTACTGCATTTGCAAAACAGACTTCTCTACAATACCCTCGGTGATGATATTATGCCGTGGAGTGTGGAAGCTGGACGCGAGGTCATAGCGGCAAGACTTGGGAACCACAAGGTTCTTCTTGTGCTTGATGGTGTGGATAAACTGGTACAGATCCATGCTCTGGCAAAAGAGACAAGATGGTTTGGTCGTCAGAGCCGAATCATCATAACCACCCGAGACAAGGGCTTGCTCAATAGTTGTGGAGTAAAAACCATCTATGATGTTAAGTGCTTGGACGACAAGGATTCCCTGCAGATGTTTAAACAGATTGCTTTTGAAGGAGGCAGTCCTCCTTCTGTTGATTTTGAACAGCTCTCAATCCGAGCAGCTCGGCTTGCGCACGGGCTTCCTTCTGCCCTTCAAGCCTATGCCTTATTTCTCCGTGGAAGGGCCAACTCTCCTGAAGAATGGGAAGAAGCAGTATGTGGACTTGAAAGTACTCCTGACGAGAATATAATGGAAATCCTGAAAATTAGCTACGAGGGTTTAGCAAAAGCACATCAGAATGCTTTTCTCCATGTTGCATGTCTCTTTAATGGAGACACTTTCCGGCGTGTCACTTCACTACTTGATGTTAGCAGAATGGAAAGTAACTTGTGGATGAGAGTTTTAGCAGAGAAATCTCTCATCAATATAACAAGTAATGGATATGTAACCCTGCATAAGTTGGTTGAACAAATGGGAAGAGAAATTATGCTTGCCAGTGGAAAATTCATCGGGGATCCGGAGACAATTCATGATACTCTTGGAATGGGACAAACTGAAAGCATCTCCCTACACATATGTGAAATGACCTGTGCATTTTCGATGGCGACCGGTGTTTTTAGCAGAATGTATAAACTTAGGTTTTTAAAGGTCTACAAGCATGTTAACGAGAGAGAATCGATGTTGCAGGTGATTCCTGAAGATGAATACCCTTCCATAAATTGTCTCCTACTCCATTGGGACGCATTTCCATTGAGCAAATTTCCTCTCAGGTTTAATACATATTGTCTTGTTGAACTCAATCTGCGTCACAGCAACCTAGAAACACTCTGGAGTGGAGTACTGAAGTTTGGTCATTTGAGGAAACTAGATGTGACGGGATCTAAGAATCTCAAACAACTTCCAGATCTTTCATGTGCCGAGGAGCTTGACGAGTTGCTTCTAGAACAATGCAAGAGACTAAAAGGAATTCCAGAGTCCATTGCAGAGAGGTCTACCCTAGGCAGGCTTAATCTATCATACTACGGTGGGGCTAAGAATCCCATGGGTGTTGTTATACAGAAAGTTTCTCAGACGCAACGTATTACATTGTTGTTCCCAACTTCAAGCGTGGAAATGCAACTTATGAATATATCAATCACGGGAGACATTAGATTTCGTGTTTTTGCAGATTTTGAAGGATATGCTGAATACTTCTCCTTTAGTACTGAGCAAAAGATCCATGCTACAAGGACAGTAAGTGTCCACCAAGCTCCTCGGCTCATCTCGGAGCTTAACAAATCTACTACACTCAATATCAGGAGGTTCAGCTACAAAGAGAACGGTCGACCTGTCACTTTACACAGCTTTCCAGATATTCCTGGCCTGAAACAGCTAGAACTAGTCAACTTAAACATCCAAAAACTGTCAGATGGGATTGGTCACTTTGAGTTCCTAGAAAATCTGGATCTCAGCGGAAATGATTTTGAGAATTTACCAGAAGATATGAATAGACTTTCCCGATTGAAAACTCTCTGTCTCCGAAACTGCAGCAAACTCAAGGAATTGCCAGAGCTAACTCAGGTGCAGTCACTCACTCTTTCTAACTGTAAGAACCTCAGATCTTTGGTGAAAATCTCTGATGCAAGTCAAGATCCAAGCTTATACAGTTTGCTTGAGCTTTGCCTTGACAACTGCAAGAATGTGAAGTCATTGTCAGACCAGCTTAGTCATTTCCCCAAGTTGGCATATTTAGATCTCAGCAGCCATGACTTTAAGAAACTGCCATCAAGCATCAGAGATCTTACCTCATTGGTAACTCTCTGCCTGAATAACTGCAAGAAACTCAAATCACTGGAAGAACTCCCACTGAGCCTCCAGTTTCTCGACGCAAAGGGTTGTGATTCTCTTGAAGCTGATGATTTAGAACATTTCAAAGGGAGAGTAAACAGAGAGGTATCAGCACAACCACATAGTGCTCGCTTCCAAGAAACGGAGATGCCAAGTTACGAGCAGGATCACCAAGCCAGAAAGAGTCGCCTACCCAAGTTCCTATGCTGCTCATATTTCTAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSASRASSYDVFLSFRGEDTRHSIVSHLYEALTSRGIATFKDDKRLELGDHISEELQRAIEGSDFVVVVLSENYPTSRWCLMELQSIMELQMEGRLGVFPVFYRVEPSAVRYQLGSFDLEGYQRDPQMADMVPKWRQALKLIADLSGVASGQCIDEATMVRKIVEDISKRKTLKHKIDFRNFVGVDTHLQGLKSLLDMDSNNDEVRMIGIWGMGGIGKTTIAKCLYDQLSSQFTASYFTQDIKGIHKELDLLHLQNRLLYNTLGDDIMPWSVEAGREVIAARLGNHKVLLVLDGVDKLVQIHALAKETRWFGRQSRIIITTRDKGLLNSCGVKTIYDVKCLDDKDSLQMFKQIAFEGGSPPSVDFEQLSIRAARLAHGLPSALQAYALFLRGRANSPEEWEEAVCGLESTPDENIMEILKISYEGLAKAHQNAFLHVACLFNGDTFRRVTSLLDVSRMESNLWMRVLAEKSLINITSNGYVTLHKLVEQMGREIMLASGKFIGDPETIHDTLGMGQTESISLHICEMTCAFSMATGVFSRMYKLRFLKVYKHVNERESMLQVIPEDEYPSINCLLLHWDAFPLSKFPLRFNTYCLVELNLRHSNLETLWSGVLKFGHLRKLDVTGSKNLKQLPDLSCAEELDELLLEQCKRLKGIPESIAERSTLGRLNLSYYGGAKNPMGVVIQKVSQTQRITLLFPTSSVEMQLMNISITGDIRFRVFADFEGYAEYFSFSTEQKIHATRTVSVHQAPRLISELNKSTTLNIRRFSYKENGRPVTLHSFPDIPGLKQLELVNLNIQKLSDGIGHFEFLENLDLSGNDFENLPEDMNRLSRLKTLCLRNCSKLKELPELTQVQSLTLSNCKNLRSLVKISDASQDPSLYSLLELCLDNCKNVKSLSDQLSHFPKLAYLDLSSHDFKKLPSSIRDLTSLVTLCLNNCKKLKSLEELPLSLQFLDAKGCDSLEADDLEHFKGRVNREVSAQPHSARFQETEMPSYEQDHQARKSRLPKFLCCSYF

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSASRASSYDVFLSFRGEDTRHSIVSHLYEALTSRGIATFKDDKRLELGDHISEELQRAIEGSDFVVVVLSENYPTSRWCLMELQSIMELQMEGRLGVFPVFYRVEPSAVRYQLGSFDLEGYQRDPQMADMVPKWRQALKLIADLSGV

Gene3D: G3DSA:3.40.50.10140
9-120 G3DSA:3.40.50.10140

ASSYDVFLSFRGEDTRHSIVSHLYEALTSRGIATFKDDKRLELGDHISEELQRAIEGSDFVVVVLSENYPTSRWCLMELQSIMELQMEGRLGVFPVFYRVEPSAVRYQLGSF

ProfileScan: PS50104
IPR000157
10-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSYDVFLSFRGEDTRHSIVSHLYEALTSRGIATFKDDKRLELGDHISEELQRAIEGSDFVVVVLSENYPTSRWCLMELQSIMELQMEGRLGVFPVFYRVEPSAVRYQLGSFDLEGYQRDPQMADMVPKWRQALKLIADL

HMMSmart: SM00255
IPR000157
11-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SYDVFLSFRGEDTRHSIVSHLYEALTSRGIATFKDDKRLELGDHISEELQRAIEGSDFVVVVLSENYPTSRWCLMELQSIMELQMEGRLGVFPVFYRVEPSAVRYQLGSFDLEGYQRDPQMADMVPKWRQALKLIADL

HMMPfam: PF01582
IPR000157
14-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRHSIVSHLYEALTSRGIATFKDDKRLELGDHISEELQRAIEGSDFVVVVLSENYPTSRWCLMELQSIMELQMEGRLGVFPVFYRVEPSAVRYQLGSFDLEGYQRDPQMADMVPKWRQALK

HMMPanther: PTHR23155:SF344
23-1001 PTHR23155:SF344

TRHSIVSHLYEALTSRGIATFKDDKRLELGDHISEELQRAIEGSDFVVVVLSENYPTSRWCLMELQSIMELQMEGRLGVFPVFYRVEPSAVRYQLGSFDLEGYQRDPQMADMVPKWRQALKLIADLSGVASGQCIDEATMVRKIVEDISKRKTLKHKIDFRNFVGVDTHLQGLKSLLDMDSNNDEVRMIGIWGMGGIGKTTIAKCLYDQLSSQFTASYFTQDIKGIHKELDLLHLQNRLLYNTLGDDIMPWSVEAGREVIAARLGNHKVLLVLDGVDKLVQIHALAKETRWFGRQSRIIITTRDKGLLNSCGVKTIYDVKCLDDKDSLQMFKQIAFEGGSPPSVDFEQLSIRAARLAHGLPSALQAYALFLRGRANSPEEWEEAVCGLESTPDENIMEILKISYEGLAKAHQNAFLHVACLFNGDTFRRVTSLLDVSRMESNLWMRVLAEKSLINITSNGYVTLHKLVEQMGREIMLASGKFIGDPETIHDTLGMGQTESISLHICEMTCAFSMATGVFSRMYKLRFLKVYKHVNERESMLQVIPEDEYPSINCLLLHWDAFPLSKFPLRFNTYCLVELNLRHSNLETLWSGVLKFGHLRKLDVTGSKNLKQLPDLSCAEELDELLLEQCKRLKGIPESIAERSTLGRLNLSYYGGAKNPMGVVIQKVSQTQRITLLFPTSSVEMQLMNISITGDIRFRVFADFEGYAEYFSFSTEQKIHATRTVSVHQAPRLISELNKSTTLNIRRFSYKENGRPVTLHSFPDIPGLKQLELVNLNIQKLSDGIGHFEFLENLDLSGNDFENLPEDMNRLSRLKTLCLRNCSKLKELPELTQVQSLTLSNCKNLRSLVKISDASQDPSLYSLLELCLDNCKNVKSLSDQLSHFPKLAYLDLSSHDFKKLPSSIRDLTSLVTLCLNNCKKLKSLEELPLSLQFLDAKGCDSLEADDLEHFKGRVNREVSAQPHSARFQETEMPSYEQDH

HMMPanther: PTHR23155
23-1001 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRHSIVSHLYEALTSRGIATFKDDKRLELGDHISEELQRAIEGSDFVVVVLSENYPTSRWCLMELQSIMELQMEGRLGVFPVFYRVEPSAVRYQLGSFDLEGYQRDPQMADMVPKWRQALKLIADLSGVASGQCIDEATMVRKIVEDISKRKTLKHKIDFRNFVGVDTHLQGLKSLLDMDSNNDEVRMIGIWGMGGIGKTTIAKCLYDQLSSQFTASYFTQDIKGIHKELDLLHLQNRLLYNTLGDDIMPWSVEAGREVIAARLGNHKVLLVLDGVDKLVQIHALAKETRWFGRQSRIIITTRDKGLLNSCGVKTIYDVKCLDDKDSLQMFKQIAFEGGSPPSVDFEQLSIRAARLAHGLPSALQAYALFLRGRANSPEEWEEAVCGLESTPDENIMEILKISYEGLAKAHQNAFLHVACLFNGDTFRRVTSLLDVSRMESNLWMRVLAEKSLINITSNGYVTLHKLVEQMGREIMLASGKFIGDPETIHDTLGMGQTESISLHICEMTCAFSMATGVFSRMYKLRFLKVYKHVNERESMLQVIPEDEYPSINCLLLHWDAFPLSKFPLRFNTYCLVELNLRHSNLETLWSGVLKFGHLRKLDVTGSKNLKQLPDLSCAEELDELLLEQCKRLKGIPESIAERSTLGRLNLSYYGGAKNPMGVVIQKVSQTQRITLLFPTSSVEMQLMNISITGDIRFRVFADFEGYAEYFSFSTEQKIHATRTVSVHQAPRLISELNKSTTLNIRRFSYKENGRPVTLHSFPDIPGLKQLELVNLNIQKLSDGIGHFEFLENLDLSGNDFENLPEDMNRLSRLKTLCLRNCSKLKELPELTQVQSLTLSNCKNLRSLVKISDASQDPSLYSLLELCLDNCKNVKSLSDQLSHFPKLAYLDLSSHDFKKLPSSIRDLTSLVTLCLNNCKKLKSLEELPLSLQFLDAKGCDSLEADDLEHFKGRVNREVSAQPHSARFQETEMPSYEQDH

superfamily: SSF52540
168-418 SSF52540

EDISKRKTLKHKIDFRNFVGVDTHLQGLKSLLDMDSNNDEVRMIGIWGMGGIGKTTIAKCLYDQLSSQFTASYFTQDIKGIHKELDLLHLQNRLLYNTLGDDIMPWSVEAGREVIAARLGNHKVLLVLDGVDKLVQIHALAKETRWFGRQSRIIITTRDKGLLNSCGVKTIYDVKCLDDKDSLQMFKQIAFEGGSPPSVDFEQLSIRAARLAHGLPSALQAYALFLRGRANSPEEWEEAVCGLESTPDENI

Gene3D: G3DSA:3.40.50.300
176-332 G3DSA:3.40.50.300

LKHKIDFRNFVGVDTHLQGLKSLLDMDSNNDEVRMIGIWGMGGIGKTTIAKCLYDQLSSQFTASYFTQDIKGIHKELDLLHLQNRLLYNTLGDDIMPWSVEAGREVIAARLGNHKVLLVLDGVDKLVQIHALAKETRWFGRQSRIIITTRDKGLLNS

HMMPfam: PF00931
IPR002182
195-450 NB-ARC,NBS
NB-ARC

LKSLLDMDSNNDEVRMIGIWGMGGIGKTTIAKCLYDQLSSQFTASYFTQDIKGIHKELDLLHLQNRLLYNTLGDDIMPWSVEAGREVIAARLGNHKVLLVLDGVDKLVQIHALAKETRWFGRQSRIIITTRDKGLLNSCGVKTIYDVKCLDDKDSLQMFKQIAFEGGSPPSVDFEQLSIRAARLAHGLPSALQAYALFLRGRANSPEEWEEAVCGLESTPDENIMEILKISYEGLAKAHQNAFLHVACLFNGDTFR

FPrintScan: PR00364
IPR000767
210-225 DISEASERSIST
Disease resistance protein

MIGIWGMGGIGKTTIA

FPrintScan: PR00364
IPR000767
285-299 DISEASERSIST
Disease resistance protein

RLGNHKVLLVLDGVD

FPrintScan: PR00364
IPR000767
379-393 DISEASERSIST
Disease resistance protein

AHGLPSALQAYALFL

superfamily: SSF46785
416-516 SSF46785

ENIMEILKISYEGLAKAHQNAFLHVACLFNGDTFRRVTSLLDVSRMESNLWMRVLAEKSLINITSNGYVTLHKLVEQMGREIMLASGKFIGDPETIHDTLG

superfamily: SSF52058
485-1007 SSF52058,LRR

TLHKLVEQMGREIMLASGKFIGDPETIHDTLGMGQTESISLHICEMTCAFSMATGVFSRMYKLRFLKVYKHVNERESMLQVIPEDEYPSINCLLLHWDAFPLSKFPLRFNTYCLVELNLRHSNLETLWSGVLKFGHLRKLDVTGSKNLKQLPDLSCAEELDELLLEQCKRLKGIPESIAERSTLGRLNLSYYGGAKNPMGVVIQKVSQTQRITLLFPTSSVEMQLMNISITGDIRFRVFADFEGYAEYFSFSTEQKIHATRTVSVHQAPRLISELNKSTTLNIRRFSYKENGRPVTLHSFPDIPGLKQLELVNLNIQKLSDGIGHFEFLENLDLSGNDFENLPEDMNRLSRLKTLCLRNCSKLKELPELTQVQSLTLSNCKNLRSLVKISDASQDPSLYSLLELCLDNCKNVKSLSDQLSHFPKLAYLDLSSHDFKKLPSSIRDLTSLVTLCLNNCKKLKSLEELPLSLQFLDAKGCDSLEADDLEHFKGRVNREVSAQPHSARFQETEMPSYEQDHQARKSR

Gene3D: G3DSA:3.80.10.10
559-675 G3DSA:3.80.10.10

RESMLQVIPEDEYPSINCLLLHWDAFPLSKFPLRFNTYCLVELNLRHSNLETLWSGVLKFGHLRKLDVTGSKNLKQLPDLSCAEELDELLLEQCKRLKGIPESIAERSTLGRLNLSY

HMMPfam: PF07725
IPR011713
597-615 LRR_3
Leucine-rich repeat 3

CLVELNLRHSNLETLWSGV

Gene3D: G3DSA:3.80.10.10
755-961 G3DSA:3.80.10.10

LISELNKSTTLNIRRFSYKENGRPVTLHSFPDIPGLKQLELVNLNIQKLSDGIGHFEFLENLDLSGNDFENLPEDMNRLSRLKTLCLRNCSKLKELPELTQVQSLTLSNCKNLRSLVKISDASQDPSLYSLLELCLDNCKNVKSLSDQLSHFPKLAYLDLSSHDFKKLPSSIRDLTSLVTLCLNNCKKLKSLEELPLSLQFLDAKGC

FPrintScan: PR00364
IPR000767
831-847 DISEASERSIST
Disease resistance protein

NRLSRLKTLCLRNCSKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox