PRGDB00047059 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18422528 (NM_123891)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G45230) mRNA, complete cds.

DNA Sequence

ATGGTGACATCTTCCGACGTCAAAGTAGAACCACAAGTGTTTATCAATTTCCGAGGAGATGAGCTACGCAAGACCTTCATCTCCCATCTCCATAAAAGATTGCAACGCGATGGGATCAATGCTTTTATAGACTCTGATGAAGCTGTTGGCGAAGAACTCAAAAACCTTTTCAAAAGGATTGAGAATTCGGAGATCGCACTGGCGGTTTTATCGAGTAGGTACACGGAGTCACATTGGTGTTTGCAGGAGCTAGTTAAGATGATGGAATGTAGTATGAAAGGTGAAGGATGCAATAAAAAATTATTGGTCATTCCAATTTTTTACAAGCTGAAGATAGACACGGTGAAAGAGCTTGATGGAGATTTCGGTCGTAATCTGTGGGATCTCTGGAGGAAGCCGGGTTGCGGTCGTGATCGAGACAGCCGGATTGTTAAGTGGAACGAGGCTTTGAAGTACTTTCTCAGCAGAAATGCCTTGGTATTTTCAGAAACTGGAAAGGAAGAGGAATTCGTGTCTACGATCGCCACACATGTTAAAAATGCCCTAAGCAAAATTACGCCGCAAAGAGGAGAAAACCCGAAACCACAGAAAGGAGCAGGAAACCCTAAGCCCCAAAAAATTCTTAGCAGAGCAGCAAACATTACTGAACCAGAGGATCAACGCCTTAAGCAACTAGCAGTAAAGTTGAATGTGGAGTGCAATGACAACGAAACTCGTATTGTTGAAGTCGTAGGGATGCCCGGAATCGGCAAAACCTATCTCGCCAAGAAACTCTTCGCCAAGCTTAAGAAGAAGATCAACCATTGTGTGTTCATCGAGTTCAAGCGTGAGATGTCAGCGGAGCAAGGATCAGAGTGGCTACAGAAGAGACTTGTGGAAGGTTTGCTGGATATTCAAGATTGCACCGATACAAATGCACTTGAGGTTTGGAAGGATAGCTTAATCGACAAGAAAGTCGTGATTGTTTTCGATGATGTGAGTGACAAAAAACAGATATCCGAACCACTTAAGGGTATCTGCGACTGGATTAAGAAGGGGAGCATGATCGTCATCACGACACGGGACAAGTCATTGACTGAGGGATTAGTCACTGATCTTTATGAAGTCCCTGGGTTGAATGAGAGAGACGGCTTAGAGCTCTTTAGGGCTCAAGTCTGTTGTAATATTGAAGGAAATTTCATGGAGCTATCTAGAAAGTTTGTGGATTTTGCACGAGGCAACCCCTTAGCTCTCGAGGAATTCGGTAAGGAGCTTCGCGGGAAAGACGAGGCTCACTGGGAAACAAGACTTGGGACACTGGCACAGCATTCCAATCCAACGATCAGAGAGAAGCTAAGAAGCTCTTATGATGAACTAAACGAGCAGCAGAAGGATGCGTTTCTTGATATAGCTTATTTCTTTAGGTCACAAGATGAGAGCTACGTTAGAAGTTTACTTGATTCTTATGACCCTGAATCCGCGGAATCTGGTCAAGAATTTAGAGACCTCGCAGACAAATTCTTGATTGGCGTGTGTGATGGTCGAGTTGAGATGCATGATCTATTATTTACAATGGCCAAGGAGATTGTTGAAGCTACTGCAGAGAAATCAAGATTGTTGCTGTCGAGTTGTGCAGAGTTGAAAAATAAAGAGTTGTCTCTTGATCAACAGGGAAGAGACAAGGTTAGAGGAATTGTTTTAGACATGTCTGAAATGGAGGAAAAGCCCTTAAAGAGAGCAGTTTTTGTCGGTATGAGCAGTCTACGGTACCTGAAAGTCTACAGTTCTCTTTGTCCTACTCACTCTAAAACTGAGTGCAAGTTACACTTACCTGATGGACTTGAATTTCCAAAAGATAATATTGTCCGATGTCTTCACTGGGTGAAATTTCCAGGGACAGAACTTCCACCAGACTTTTACCCCAATAATCTCATCGATCTTAGGTTACCTTACAGCAATATTACCACTCTATGGAGCTGTACTAAGGTTGCACCTAATCTGAAGTGGGTTGATCTCAGCCACTCGAGTAACTTGAATTCCTTGATGGGTTTATCAGAAGCACCAAATCTTTTGAGATTAAATCTTGAAGGCTGCACAAGTTTAAAGGAGTTACCTGATGAGATGAAAGATATGACGAATCTTGTTTTCCTGAACTTAAGAGGATGCACAAGCCTCTTGTCTCTACCAAAGATCACTACGAATTCCTTGAAGACTCTCATTCTTAGCGGCTGCTCAAGCTTTCAGACATTTGAGGTGATTTCAGAACATCTAGAGTCTCTATACTTAAACGGCACAGAGATAAATGGACTTCCTCCAGCCATTGGTAATCTCCATAGACTTATCTTTTTAAATTTGAAAGATTGCAAAAATCTAGCGACTCTTCCTGATTGTCTTGGGGAGCTTAAATCTCTTCAAGAACTCAAACTCTCTCGCTGCTCAAAGCTCAAAATTTTCCCCGATGTTACGGCGAAAATGGAAAGTTTGCTGGTTTTACTGCTCGATGGGACATCAATAGCAGAGTTGCCATGCAGCATTTTTCACTTATCTTCTCTGCGACGTCTATGCTTAAGCAGGAATGATAATATCCGCACCCTTCGATTTGACATGGGTCACATGTTCCATCTGAAGTGGCTTGAGTTAAAGTATTGTAAGAATCTCACATCTCTTCCCATACTTCCACCAAATCTTCAGTGCTTAAATGCACATGGCTGTACTTCACTAAGAACAGTCGCCAGCCCGCAAACCCTTCCTACACCAACAGAGCAGATTCATTCCACCTTTATTTTCACTAACTGTCACGAACTAGAACAAGTCTCAAAGAATGCTATCATTTCTTACGTTCAGAAAAAAAGCAAATTGATGTCAGCTGATCGATATAGTCCGGATTTTGTTTACAAATCCTTGATTGGTACTTGCTTTCCGGGATGTGAGATACCTGCATGGTTTAATCACCAAGCACTGGGATCAGTCTTAATCCTGGAACTTCCTCAAGCTTGGAATTCAAGTAGGATAATCGGGATAGCTCTATGTGTTGTAGTCTCGTTTAAGGAGTATAGAGACCAAAACAGCAGTCTCCAAGTGCAGTGCACGTGTGAGTTTACGAATGTATCCTTGAGCCAGGAAAGCTTCATGGTTGGTGGCTGGTCTGAACAAGGCGATGAGACACATACGGTTGAGTCAGACCATATTTTCATTGGCTACACCACTTTGCTTAATATAAAGAACCGTCAACAGTTTCCATTAGCTACTGAAATTTCCCTTCGATTTCAAGTGACAAATGGTACAAGCGAGGTCGAAAAATGCAAGGTGATAAAGTGTGGCTTCTCTTTGGTGTATGAGCCTAATGAAGCTGATAGCACATCTTGGAAGGAAACTCCAAGGATGGAGGATAATAGACAAGACCGGAGAATCTCTTTTAAAACTGGAGAAGGTGATGACTGCCCCATTGCAACTCCAACAACAGCGGATTCTAAGAAGGGCAATAGTTTGTTCAGTTACTTTCTGGGGAGAGATACATCTATTACAAAAAAAGGTTTTAAGATTCCGAAGCAGATTGACGTGGGTATGAGGAAGTACAGCCAAATGAAGTTTCAGAACGAACAAGTTGAAGTAGAGCATTTTCCCGGAAATGAGCAAAAGGCTAACATTTTGAAAAATGCACTTGGAAGAATCAAATTTAAGGAGACGAGAGATGTCGTTGGAGTTCAAGATGTGTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MVTSSDVKVEPQVFINFRGDELRKTFISHLHKRLQRDGINAFIDSDEAVGEELKNLFKRIENSEIALAVLSSRYTESHWCLQELVKMMECSMKGEGCNKKLLVIPIFYKLKIDTVKELDGDFGRNLWDLWRKPGCGRDRDSRIVKWNEALKYFLSRNALVFSETGKEEEFVSTIATHVKNALSKITPQRGENPKPQKGAGNPKPQKILSRAANITEPEDQRLKQLAVKLNVECNDNETRIVEVVGMPGIGKTYLAKKLFAKLKKKINHCVFIEFKREMSAEQGSEWLQKRLVEGLLDIQDCTDTNALEVWKDSLIDKKVVIVFDDVSDKKQISEPLKGICDWIKKGSMIVITTRDKSLTEGLVTDLYEVPGLNERDGLELFRAQVCCNIEGNFMELSRKFVDFARGNPLALEEFGKELRGKDEAHWETRLGTLAQHSNPTIREKLRSSYDELNEQQKDAFLDIAYFFRSQDESYVRSLLDSYDPESAESGQEFRDLADKFLIGVCDGRVEMHDLLFTMAKEIVEATAEKSRLLLSSCAELKNKELSLDQQGRDKVRGIVLDMSEMEEKPLKRAVFVGMSSLRYLKVYSSLCPTHSKTECKLHLPDGLEFPKDNIVRCLHWVKFPGTELPPDFYPNNLIDLRLPYSNITTLWSCTKVAPNLKWVDLSHSSNLNSLMGLSEAPNLLRLNLEGCTSLKELPDEMKDMTNLVFLNLRGCTSLLSLPKITTNSLKTLILSGCSSFQTFEVISEHLESLYLNGTEINGLPPAIGNLHRLIFLNLKDCKNLATLPDCLGELKSLQELKLSRCSKLKIFPDVTAKMESLLVLLLDGTSIAELPCSIFHLSSLRRLCLSRNDNIRTLRFDMGHMFHLKWLELKYCKNLTSLPILPPNLQCLNAHGCTSLRTVASPQTLPTPTEQIHSTFIFTNCHELEQVSKNAIISYVQKKSKLMSADRYSPDFVYKSLIGTCFPGCEIPAWFNHQALGSVLILELPQAWNSSRIIGIALCVVVSFKEYRDQNSSLQVQCTCEFTNVSLSQESFMVGGWSEQGDETHTVESDHIFIGYTTLLNIKNRQQFPLATEISLRFQVTNGTSEVEKCKVIKCGFSLVYEPNEADSTSWKETPRMEDNRQDRRISFKTGEGDDCPIATPTTADSKKGNSLFSYFLGRDTSITKKGFKIPKQIDVGMRKYSQMKFQNEQVEVEHFPGNEQKANILKNALGRIKFKETRDVVGVQDV

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-159 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TSSDVKVEPQVFINFRGDELRKTFISHLHKRLQRDGINAFIDSDEAVGEELKNLFKRIENSEIALAVLSSRYTESHWCLQELVKMMECSMKGEGCNKKLLVIPIFYKLKIDTVKELDGDFGRNLWDLWRKPGCGRDRDSRIVKWNEALKYFLSRNAL

ProfileScan: PS50104
IPR000157
9-156 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VEPQVFINFRGDELRKTFISHLHKRLQRDGINAFIDSDEAVGEELKNLFKRIENSEIALAVLSSRYTESHWCLQELVKMMECSMKGEGCNKKLLVIPIFYKLKIDTVKELDGDFGRNLWDLWRKPGCGRDRDSRIVKWNEALKYFLSR

HMMSmart: SM00255
IPR000157
10-156 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EPQVFINFRGDELRKTFISHLHKRLQRDGINAFIDSDEAVGEELKNLFKRIENSEIALAVLSSRYTESHWCLQELVKMMECSMKGEGCNKKLLVIPIFYKLKIDTVKELDGDFGRNLWDLWRKPGCGRDRDSRIVKWNEALKYFLSR

Gene3D: G3DSA:3.40.50.10140
12-124 G3DSA:3.40.50.10140

QVFINFRGDELRKTFISHLHKRLQRDGINAFIDSDEAVGEELKNLFKRIENSEIALAVLSSRYTESHWCLQELVKMMECSMKGEGCNKKLLVIPIFYKLKIDTVKELDGDFGR

HMMPfam: PF01582
IPR000157
13-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFINFRGDELRKTFISHLHKRLQRDGINAFIDSDEAVGEELKNLFKRIENSEIALAVLSSRYTESHWCLQELVKMMECSMKGEGCNKKLLVIPIFYKLKIDTVKELDGDFGRNLWDLWRKPGCGRDRDSRIVKWNEALK

HMMPanther: PTHR23155:SF245
20-938 PTHR23155:SF245,SUBFAMILY NOT NAMED

DELRKTFISHLHKRLQRDGINAFIDSDEAVGEELKNLFKRIENSEIALAVLSSRYTESHWCLQELVKMMECSMKGEGCNKKLLVIPIFYKLKIDTVKELDGDFGRNLWDLWRKPGCGRDRDSRIVKWNEALKYFLSRNALVFSETGKEEEFVSTIATHVKNALSKITPQRGENPKPQKGAGNPKPQKILSRAANITEPEDQRLKQLAVKLNVECNDNETRIVEVVGMPGIGKTYLAKKLFAKLKKKINHCVFIEFKREMSAEQGSEWLQKRLVEGLLDIQDCTDTNALEVWKDSLIDKKVVIVFDDVSDKKQISEPLKGICDWIKKGSMIVITTRDKSLTEGLVTDLYEVPGLNERDGLELFRAQVCCNIEGNFMELSRKFVDFARGNPLALEEFGKELRGKDEAHWETRLGTLAQHSNPTIREKLRSSYDELNEQQKDAFLDIAYFFRSQDESYVRSLLDSYDPESAESGQEFRDLADKFLIGVCDGRVEMHDLLFTMAKEIVEATAEKSRLLLSSCAELKNKELSLDQQGRDKVRGIVLDMSEMEEKPLKRAVFVGMSSLRYLKVYSSLCPTHSKTECKLHLPDGLEFPKDNIVRCLHWVKFPGTELPPDFYPNNLIDLRLPYSNITTLWSCTKVAPNLKWVDLSHSSNLNSLMGLSEAPNLLRLNLEGCTSLKELPDEMKDMTNLVFLNLRGCTSLLSLPKITTNSLKTLILSGCSSFQTFEVISEHLESLYLNGTEINGLPPAIGNLHRLIFLNLKDCKNLATLPDCLGELKSLQELKLSRCSKLKIFPDVTAKMESLLVLLLDGTSIAELPCSIFHLSSLRRLCLSRNDNIRTLRFDMGHMFHLKWLELKYCKNLTSLPILPPNLQCLNAHGCTSLRTVASPQTLPTPTEQIHSTFIFTNCHELEQVSKNAIIS

HMMPanther: PTHR23155
20-938 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DELRKTFISHLHKRLQRDGINAFIDSDEAVGEELKNLFKRIENSEIALAVLSSRYTESHWCLQELVKMMECSMKGEGCNKKLLVIPIFYKLKIDTVKELDGDFGRNLWDLWRKPGCGRDRDSRIVKWNEALKYFLSRNALVFSETGKEEEFVSTIATHVKNALSKITPQRGENPKPQKGAGNPKPQKILSRAANITEPEDQRLKQLAVKLNVECNDNETRIVEVVGMPGIGKTYLAKKLFAKLKKKINHCVFIEFKREMSAEQGSEWLQKRLVEGLLDIQDCTDTNALEVWKDSLIDKKVVIVFDDVSDKKQISEPLKGICDWIKKGSMIVITTRDKSLTEGLVTDLYEVPGLNERDGLELFRAQVCCNIEGNFMELSRKFVDFARGNPLALEEFGKELRGKDEAHWETRLGTLAQHSNPTIREKLRSSYDELNEQQKDAFLDIAYFFRSQDESYVRSLLDSYDPESAESGQEFRDLADKFLIGVCDGRVEMHDLLFTMAKEIVEATAEKSRLLLSSCAELKNKELSLDQQGRDKVRGIVLDMSEMEEKPLKRAVFVGMSSLRYLKVYSSLCPTHSKTECKLHLPDGLEFPKDNIVRCLHWVKFPGTELPPDFYPNNLIDLRLPYSNITTLWSCTKVAPNLKWVDLSHSSNLNSLMGLSEAPNLLRLNLEGCTSLKELPDEMKDMTNLVFLNLRGCTSLLSLPKITTNSLKTLILSGCSSFQTFEVISEHLESLYLNGTEINGLPPAIGNLHRLIFLNLKDCKNLATLPDCLGELKSLQELKLSRCSKLKIFPDVTAKMESLLVLLLDGTSIAELPCSIFHLSSLRRLCLSRNDNIRTLRFDMGHMFHLKWLELKYCKNLTSLPILPPNLQCLNAHGCTSLRTVASPQTLPTPTEQIHSTFIFTNCHELEQVSKNAIIS

HMMPfam: PF00931
IPR002182
220-471 NB-ARC,NBS
NB-ARC

QRLKQLAVKLNVECNDNETRIVEVVGMPGIGKTYLAKKLFAKLKKKINHCVFIEFKREMSAEQGSEWLQKRLVEGLLDIQDCTDTNALEVWKDSLIDKKVVIVFDDVSDKKQISEPLKGICDWIKKGSMIVITTRDKSLTEGLVTDLYEVPGLNERDGLELFRAQVCCNIEGNFMELSRKFVDFARGNPLALEEFGKELRGKDEAHWETRLGTLAQHSNPTIREKLRSSYDELNEQQKDAFLDIAYFFRSQD

superfamily: SSF52540
222-441 SSF52540

LKQLAVKLNVECNDNETRIVEVVGMPGIGKTYLAKKLFAKLKKKINHCVFIEFKREMSAEQGSEWLQKRLVEGLLDIQDCTDTNALEVWKDSLIDKKVVIVFDDVSDKKQISEPLKGICDWIKKGSMIVITTRDKSLTEGLVTDLYEVPGLNERDGLELFRAQVCCNIEGNFMELSRKFVDFARGNPLALEEFGKELRGKDEAHWETRLGTLAQHSNPTI

Gene3D: G3DSA:3.40.50.300
226-365 G3DSA:3.40.50.300

AVKLNVECNDNETRIVEVVGMPGIGKTYLAKKLFAKLKKKINHCVFIEFKREMSAEQGSEWLQKRLVEGLLDIQDCTDTNALEVWKDSLIDKKVVIVFDDVSDKKQISEPLKGICDWIKKGSMIVITTRDKSLTEGLVTD

FPrintScan: PR00364
IPR000767
240-255 DISEASERSIST
Disease resistance protein

IVEVVGMPGIGKTYLA

FPrintScan: PR00364
IPR000767
313-327 DISEASERSIST
Disease resistance protein

SLIDKKVVIVFDDVS

FPrintScan: PR00364
IPR000767
404-418 DISEASERSIST
Disease resistance protein

ARGNPLALEEFGKEL

superfamily: SSF46785
439-528 SSF46785

PTIREKLRSSYDELNEQQKDAFLDIAYFFRSQDESYVRSLLDSYDPESAESGQEFRDLADKFLIGVCDGRVEMHDLLFTMAKEIVEATAE

superfamily: SSF52058
522-916 SSF52058,LRR

IVEATAEKSRLLLSSCAELKNKELSLDQQGRDKVRGIVLDMSEMEEKPLKRAVFVGMSSLRYLKVYSSLCPTHSKTECKLHLPDGLEFPKDNIVRCLHWVKFPGTELPPDFYPNNLIDLRLPYSNITTLWSCTKVAPNLKWVDLSHSSNLNSLMGLSEAPNLLRLNLEGCTSLKELPDEMKDMTNLVFLNLRGCTSLLSLPKITTNSLKTLILSGCSSFQTFEVISEHLESLYLNGTEINGLPPAIGNLHRLIFLNLKDCKNLATLPDCLGELKSLQELKLSRCSKLKIFPDVTAKMESLLVLLLDGTSIAELPCSIFHLSSLRRLCLSRNDNIRTLRFDMGHMFHLKWLELKYCKNLTSLPILPPNLQCLNAHGCTSLRTVASPQTLPTPTEQI

Gene3D: G3DSA:3.80.10.10
624-781 G3DSA:3.80.10.10

PGTELPPDFYPNNLIDLRLPYSNITTLWSCTKVAPNLKWVDLSHSSNLNSLMGLSEAPNLLRLNLEGCTSLKELPDEMKDMTNLVFLNLRGCTSLLSLPKITTNSLKTLILSGCSSFQTFEVISEHLESLYLNGTEINGLPPAIGNLHRLIFLNLKDC

HMMPfam: PF07725
IPR011713
636-655 LRR_3
Leucine-rich repeat 3

NLIDLRLPYSNITTLWSCTK

Gene3D: G3DSA:3.80.10.10
788-901 G3DSA:3.80.10.10

PDCLGELKSLQELKLSRCSKLKIFPDVTAKMESLLVLLLDGTSIAELPCSIFHLSSLRRLCLSRNDNIRTLRFDMGHMFHLKWLELKYCKNLTSLPILPPNLQCLNAHGCTSLR

FPrintScan: PR00364
IPR000767
792-808 DISEASERSIST
Disease resistance protein

GELKSLQELKLSRCSKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox