PRGDB00047060 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18422525 (NM_123888)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G45200) mRNA, complete cds.

DNA Sequence

ATGGCGACTTCCTCCTCAAACGTAGTGGTTCACCAGCAGCAGCCGCCGCCGCAACATAAAGTGTTCATAAATTTCCGAGGAGCTGAGCTGCGACACAAGTTCATCAGTCATCTACTGAAAGCCTTGGAGAGGGAAAGAATCAACGTGTTCATAGACACTCGAGAAACAATGGGCACAGGTCTGGAAAACCTATTCCAGAGAATACAAGAGTCGAAGATTGCGATTGTGGTCATTTCAAGCAGGTACACTGAGTCACAATGGTGCTTAAATGAGCTGGTAAAGATCAAAGAGTGTGTGGAGGCAGGGACCTTGGTGGTATTTCCAGTGTTCTACAAGGTGGACGTTAAAATCGTGAGGTTCCTAACAGGATCGTTTGGTGAAAAATTAGAAACATTAGTGTTGCGTCATAGTGAAAGATATGAGCCATGGAAGCAGGCTCTAGAGTTTGTGACCTCGAAGACAGGCAAGAGGGTGGAGGAAAATAGCGACGAGGGTGCGGAGGTTGAACAAATCGTGGAGCATGTAAAGGAAATCCTAAGAACAATTTCAGGGGAGATTCCACGAGGAAGAGAAAGTGAATCGCCGAGAGGAGAAGGAGAAGGAGAAGCAGAGCCTAAGACTACTCCTTCAGATGATTCTCTACTCCATGGGATTGAAACAAGGGTAGAGCAACTAAAAGAGAAGCTAGAGTTGAAATCTGAAAATGTCACTCGCTTTATCGGCGTTGTTGGGATGCCTGGAATAGGTAAAACGACTCTTGCCAAGAGACTATTCAGTGAATGTGGAAAACATTTCCTGCATAAGATGTTTCTAGATGACGTGAGCCAGAAGCCAGAGCCTTTTTTAGACGAGACGCTGCACACGGACCTATTGCTCGGGTTATGGAAGAGCAAAAACAATGGGAGAGATGGAAATAGAGCCAAGTTATCGATTGACTACATAAAGACTCAACTACAAGGAAAAAAAGTTTTTGTTGTTCTTGACAATGTGGGTGACAAGAGTCAGATAGATAAGATTCTTGGTGGGTGTGACTGGATAAAAGCAGGAAGCAGAATTGTGATCACAACGAGCAGCAAATCGGTGATTCAAGGACTCAACAGCACTTATCTCGTCCCGGGGCTGAGTAGCTGTGATGCCCTAAACCATTTCAACTATCACGCGTTTTCTGCTAGTGACGGTTTCTACCAGCCAAGTTTCACGGATCTTGCAAAACAGTTTGTGGATTACTCTATGGGACATCCATCAGTTCTCAAGCTGCTTGCTCGTGAGCTTCGTAGTAAAGACGAGAGTTACTGGAAAGAAAAGCTTAGTGCTCTTGCTAATAGCCCAAGCAACACGATTCAAGATGTTTTGAGAATACCTTATGACGAGCTTAAGGAGCAGCACAAGATCGTGTTCCTCGACATTGCCTATTTCTTCAGGTTTGAGAATGAGAGTTACGTGAGGAGATTGCTTGGTTCTTCGGCTCACGCAGATGCGAGTGAAATAACTGATCTAGCCGATAAGTTTTTGATCGACATTAGTGGCGATCGTGTCGAGATGAATGATCTGTTGTATACTTTCGCGATAGGTCTGAATTCGCAAGCATCCTCTGAAAATACAACAAGTGAGCGTAGGCTCTCAAAGCACTCTGAGATTGTTGATGTTCTCATGAACAAAGCGGAAGCAACCAAGGTCAGAGGAGTTTACCTTGACATGTTCGAGGTAAAGGAAATGGGCTTAGACAGTGACACGTTCAACAAAATGGATGATCTCAGATACTTGAAGTTCTACAATTCTCATTGTCATAGAGAATGTGAAGCTGAAGACAGCAAACTAAACTTCCCCGAGGGACTCGAGTTCCTGCCGCAAGAGCTTCGATATCTTAACTGGCTTAAATATCCGGAGAAGAACCTTCCTATAAATTTTGACCCAAAGAATCTTATCGACCTCAAGCTGCCTTATAGTCAGATTGAGCAGATTTGGGAGGAGGAGAAGGATACATCCAACTTACAGTGGCTGGATCTGAATCATTCAAGTAAGCTGCACTCATTATCGGGTTTATCGCGGGCTCAAAAGCTTCAAAGTATAAACCTTGAAGGCTGCACGGGACTGAAGACGCTTCCTCAAGTGCTGCAGAACATGGAAAGTCTCATGTTCCTGAATCTGAGAGGATGTACGAGCCTCGAGTCTCTTCCAGATATAACATTGGTTGGTCTAAGAACTTTAATCCTCAGCAACTGCTCAAGGTTTAAGGAATTCAAGCTGATTGCAAAGAATCTTGAAGAATTGTACTTAGATGGCACTGCCATTAAGGAACTTCCTTCAACAATCGGAGACCTCCAAAAGCTTATCTCGCTGAAACTGAAAGACTGCAAGAATCTGTTGAGTCTCCCTGACTCTATAGGAAACCTAAAAGCTATTCAAGAAATAATACTCTCTGGTTGTTCAAGCCTTGAGAGTTTCCCAGAAGTTAACCAAAACTTGAAACACTTAAAGACTTTACTACTAGACGGAACAGCCATAAAGAAGATTCCTGACATTTTGCATCACCTATCTCCTGATCAAGGCCTGACATCTTCCCAATCAAACTGCCATTTGTGTGAATGGCCGCGTGGAATCTACGGATTATCGTCAGTGCGACGTTTATCTCTGAGCAGTAATGAGTTCAGAATCTTGCCGAGGAGTATTGGTTATCTCTACCATCTAAACTGGCTTGACTTGAAGCACTGCAAGAATCTTGTCTCTGTTCCAATGCTTCCACCAAATCTTCAATGGTTAGACGCACACGGCTGCATTTCATTGGAAACGATTTCCATCCTTTCAGATCCTCTTCTGGCGGAAACAGAGCATTTGCACTCCACATTTATCTTCACTAACTGTACCAAACTTTATAAAGTTGAGGAGAATAGCATCGAATCCTACCCTCGGAAGAAAATCCAGTTGATGTCAAACGCACTAGCTCGCTATGAAAAGGGATTAGCTCTCGATGTTCTGATCGGAATCTGCTTTCCCGGATGGCAAGTGCCCGGGTGGTTCAATCATCGAACGGTTGGATTAGAGTTGAAGCAAAACCTGCCGCGACATTGGAACGCAGGCGGGCTTGCCGGTATAGCTCTTTGTGCTGTGGTCTCATTCAAGGACTACATATCAAAGAATAACAGGCTCTTAGTTACATGTAGCGGTGAGTTCAAAAAAGAAGACAAGACTTTGTTCCAGTTTAGTTGCATTCTTGGTGGTTGGACTGAACATGGAAGCTATGAAGCCCGCGAGATCAAGTCTGATCATGTCTTTATCGGCTACACCAGCTGGTTGAATTTCATGAAAAGTGACGACAGTATAGGATGTGTTGCAACCGAGGCTTCACTAAGATTCCAAGTTACGGACGGGACAAGAGAGGTTACAAACTGCACTGTCGTCAAGTGCGGCTTTAGTCTCATCTATTCACACACTAATGTTGATCATAGCTTGTGTACAGACAATTATTCTGATGTAACTACAACTACCAGTGGGGGTACAAGCTCCGGTTCAATAACGGACGTTGGAGAAAGTTGTTACCAAAATGGAAGTGAAGAAATCATAGAGGAAGCAATGCTTTTCGCAGCTTCAAGAGAAGTTGAAGAAGAAGAAGACACAGAGAGCTTAGTGACATTAAGCTCACTAATGGGAGAAAGTCCAAAGAGAAGTGAGAAGAAGGTACTGATGAGTGTCCGTAATGGTTCCACTAGAGAGGTAGCGATAGAGAGGGACGTTAACAACGCACATTGCCTTTCGTTTTTAAATGTGTTTAGATTTTGGCGGGATTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MATSSSNVVVHQQQPPPQHKVFINFRGAELRHKFISHLLKALERERINVFIDTRETMGTGLENLFQRIQESKIAIVVISSRYTESQWCLNELVKIKECVEAGTLVVFPVFYKVDVKIVRFLTGSFGEKLETLVLRHSERYEPWKQALEFVTSKTGKRVEENSDEGAEVEQIVEHVKEILRTISGEIPRGRESESPRGEGEGEAEPKTTPSDDSLLHGIETRVEQLKEKLELKSENVTRFIGVVGMPGIGKTTLAKRLFSECGKHFLHKMFLDDVSQKPEPFLDETLHTDLLLGLWKSKNNGRDGNRAKLSIDYIKTQLQGKKVFVVLDNVGDKSQIDKILGGCDWIKAGSRIVITTSSKSVIQGLNSTYLVPGLSSCDALNHFNYHAFSASDGFYQPSFTDLAKQFVDYSMGHPSVLKLLARELRSKDESYWKEKLSALANSPSNTIQDVLRIPYDELKEQHKIVFLDIAYFFRFENESYVRRLLGSSAHADASEITDLADKFLIDISGDRVEMNDLLYTFAIGLNSQASSENTTSERRLSKHSEIVDVLMNKAEATKVRGVYLDMFEVKEMGLDSDTFNKMDDLRYLKFYNSHCHRECEAEDSKLNFPEGLEFLPQELRYLNWLKYPEKNLPINFDPKNLIDLKLPYSQIEQIWEEEKDTSNLQWLDLNHSSKLHSLSGLSRAQKLQSINLEGCTGLKTLPQVLQNMESLMFLNLRGCTSLESLPDITLVGLRTLILSNCSRFKEFKLIAKNLEELYLDGTAIKELPSTIGDLQKLISLKLKDCKNLLSLPDSIGNLKAIQEIILSGCSSLESFPEVNQNLKHLKTLLLDGTAIKKIPDILHHLSPDQGLTSSQSNCHLCEWPRGIYGLSSVRRLSLSSNEFRILPRSIGYLYHLNWLDLKHCKNLVSVPMLPPNLQWLDAHGCISLETISILSDPLLAETEHLHSTFIFTNCTKLYKVEENSIESYPRKKIQLMSNALARYEKGLALDVLIGICFPGWQVPGWFNHRTVGLELKQNLPRHWNAGGLAGIALCAVVSFKDYISKNNRLLVTCSGEFKKEDKTLFQFSCILGGWTEHGSYEAREIKSDHVFIGYTSWLNFMKSDDSIGCVATEASLRFQVTDGTREVTNCTVVKCGFSLIYSHTNVDHSLCTDNYSDVTTTTSGGTSSGSITDVGESCYQNGSEEIIEEAMLFAASREVEEEEDTESLVTLSSLMGESPKRSEKKVLMSVRNGSTREVAIERDVNNAHCLSFLNVFRFWRD

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
7-156 TIR
Toll/interleukin-1 receptor homology (TIR) domain

NVVVHQQQPPPQHKVFINFRGAELRHKFISHLLKALERERINVFIDTRETMGTGLENLFQRIQESKIAIVVISSRYTESQWCLNELVKIKECVEAGTLVVFPVFYKVDVKIVRFLTGSFGEKLETLVLRHSERYEPWKQALEFVTSKTGK

ProfileScan: PS50104
IPR000157
17-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PQHKVFINFRGAELRHKFISHLLKALERERINVFIDTRETMGTGLENLFQRIQESKIAIVVISSRYTESQWCLNELVKIKECVEAGTLVVFPVFYKVDVKIVRFLTGSFGEKLETLVLRHSERYEPWKQALEFVTSK

HMMSmart: SM00255
IPR000157
18-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QHKVFINFRGAELRHKFISHLLKALERERINVFIDTRETMGTGLENLFQRIQESKIAIVVISSRYTESQWCLNELVKIKECVEAGTLVVFPVFYKVDVKIVRFLTGSFGEKLETLVLRHSERYEPWKQALEFVTSK

Gene3D: G3DSA:3.40.50.10140
18-132 G3DSA:3.40.50.10140

QHKVFINFRGAELRHKFISHLLKALERERINVFIDTRETMGTGLENLFQRIQESKIAIVVISSRYTESQWCLNELVKIKECVEAGTLVVFPVFYKVDVKIVRFLTGSFGEKLETL

HMMPfam: PF01582
IPR000157
21-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFINFRGAELRHKFISHLLKALERERINVFIDTRETMGTGLENLFQRIQESKIAIVVISSRYTESQWCLNELVKIKECVEAGTLVVFPVFYKVDVKIVRFLTGSFGEKLETLVLRHSERYEPWKQAL

HMMPanther: PTHR23155
28-969 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AELRHKFISHLLKALERERINVFIDTRETMGTGLENLFQRIQESKIAIVVISSRYTESQWCLNELVKIKECVEAGTLVVFPVFYKVDVKIVRFLTGSFGEKLETLVLRHSERYEPWKQALEFVTSKTGKRVEENSDEGAEVEQIVEHVKEILRTISGEIPRGRESESPRGEGEGEAEPKTTPSDDSLLHGIETRVEQLKEKLELKSENVTRFIGVVGMPGIGKTTLAKRLFSECGKHFLHKMFLDDVSQKPEPFLDETLHTDLLLGLWKSKNNGRDGNRAKLSIDYIKTQLQGKKVFVVLDNVGDKSQIDKILGGCDWIKAGSRIVITTSSKSVIQGLNSTYLVPGLSSCDALNHFNYHAFSASDGFYQPSFTDLAKQFVDYSMGHPSVLKLLARELRSKDESYWKEKLSALANSPSNTIQDVLRIPYDELKEQHKIVFLDIAYFFRFENESYVRRLLGSSAHADASEITDLADKFLIDISGDRVEMNDLLYTFAIGLNSQASSENTTSERRLSKHSEIVDVLMNKAEATKVRGVYLDMFEVKEMGLDSDTFNKMDDLRYLKFYNSHCHRECEAEDSKLNFPEGLEFLPQELRYLNWLKYPEKNLPINFDPKNLIDLKLPYSQIEQIWEEEKDTSNLQWLDLNHSSKLHSLSGLSRAQKLQSINLEGCTGLKTLPQVLQNMESLMFLNLRGCTSLESLPDITLVGLRTLILSNCSRFKEFKLIAKNLEELYLDGTAIKELPSTIGDLQKLISLKLKDCKNLLSLPDSIGNLKAIQEIILSGCSSLESFPEVNQNLKHLKTLLLDGTAIKKIPDILHHLSPDQGLTSSQSNCHLCEWPRGIYGLSSVRRLSLSSNEFRILPRSIGYLYHLNWLDLKHCKNLVSVPMLPPNLQWLDAHGCISLETISILSDPLLAETEHLHSTFIFTNCTKLYKVEENSIESYP

HMMPanther: PTHR23155:SF284
28-969 PTHR23155:SF284,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

AELRHKFISHLLKALERERINVFIDTRETMGTGLENLFQRIQESKIAIVVISSRYTESQWCLNELVKIKECVEAGTLVVFPVFYKVDVKIVRFLTGSFGEKLETLVLRHSERYEPWKQALEFVTSKTGKRVEENSDEGAEVEQIVEHVKEILRTISGEIPRGRESESPRGEGEGEAEPKTTPSDDSLLHGIETRVEQLKEKLELKSENVTRFIGVVGMPGIGKTTLAKRLFSECGKHFLHKMFLDDVSQKPEPFLDETLHTDLLLGLWKSKNNGRDGNRAKLSIDYIKTQLQGKKVFVVLDNVGDKSQIDKILGGCDWIKAGSRIVITTSSKSVIQGLNSTYLVPGLSSCDALNHFNYHAFSASDGFYQPSFTDLAKQFVDYSMGHPSVLKLLARELRSKDESYWKEKLSALANSPSNTIQDVLRIPYDELKEQHKIVFLDIAYFFRFENESYVRRLLGSSAHADASEITDLADKFLIDISGDRVEMNDLLYTFAIGLNSQASSENTTSERRLSKHSEIVDVLMNKAEATKVRGVYLDMFEVKEMGLDSDTFNKMDDLRYLKFYNSHCHRECEAEDSKLNFPEGLEFLPQELRYLNWLKYPEKNLPINFDPKNLIDLKLPYSQIEQIWEEEKDTSNLQWLDLNHSSKLHSLSGLSRAQKLQSINLEGCTGLKTLPQVLQNMESLMFLNLRGCTSLESLPDITLVGLRTLILSNCSRFKEFKLIAKNLEELYLDGTAIKELPSTIGDLQKLISLKLKDCKNLLSLPDSIGNLKAIQEIILSGCSSLESFPEVNQNLKHLKTLLLDGTAIKKIPDILHHLSPDQGLTSSQSNCHLCEWPRGIYGLSSVRRLSLSSNEFRILPRSIGYLYHLNWLDLKHCKNLVSVPMLPPNLQWLDAHGCISLETISILSDPLLAETEHLHSTFIFTNCTKLYKVEENSIESYP

superfamily: SSF52540
195-447 SSF52540

PRGEGEGEAEPKTTPSDDSLLHGIETRVEQLKEKLELKSENVTRFIGVVGMPGIGKTTLAKRLFSECGKHFLHKMFLDDVSQKPEPFLDETLHTDLLLGLWKSKNNGRDGNRAKLSIDYIKTQLQGKKVFVVLDNVGDKSQIDKILGGCDWIKAGSRIVITTSSKSVIQGLNSTYLVPGLSSCDALNHFNYHAFSASDGFYQPSFTDLAKQFVDYSMGHPSVLKLLARELRSKDESYWKEKLSALANSPSNTI

Gene3D: G3DSA:3.40.50.300
212-253 G3DSA:3.40.50.300

DSLLHGIETRVEQLKEKLELKSENVTRFIGVVGMPGIGKTTL

HMMPfam: PF00931
IPR002182
219-474 NB-ARC,NBS
NB-ARC

ETRVEQLKEKLELKSENVTRFIGVVGMPGIGKTTLAKRLFSECGKHFLHKMFLDDVSQKPEPFLDETLHTDLLLGLWKSKNNGRDGNRAKLSIDYIKTQLQGKKVFVVLDNVGDKSQIDKILGGCDWIKAGSRIVITTSSKSVIQGLNSTYLVPGLSSCDALNHFNYHAFSASDGFYQPSFTDLAKQFVDYSMGHPSVLKLLARELRSKDESYWKEKLSALANSPSNTIQDVLRIPYDELKEQHKIVFLDIAYFFR

FPrintScan: PR00364
IPR000767
239-254 DISEASERSIST
Disease resistance protein

FIGVVGMPGIGKTTLA

Gene3D: G3DSA:3.40.50.300
254-307 G3DSA:3.40.50.300

AKRLFSECGKHFLHKMFLDDVSQKPEPFLDETLHTDLLLGLWKSKNNGRDGNRA

FPrintScan: PR00364
IPR000767
317-331 DISEASERSIST
Disease resistance protein

QLQGKKVFVVLDNVG

FPrintScan: PR00364
IPR000767
410-424 DISEASERSIST
Disease resistance protein

SMGHPSVLKLLAREL

Gene3D: G3DSA:3.40.50.300
439-505 G3DSA:3.40.50.300

LANSPSNTIQDVLRIPYDELKEQHKIVFLDIAYFFRFENESYVRRLLGSSAHADASEITDLADKFLI

superfamily: SSF46785
445-551 SSF46785

NTIQDVLRIPYDELKEQHKIVFLDIAYFFRFENESYVRRLLGSSAHADASEITDLADKFLIDISGDRVEMNDLLYTFAIGLNSQASSENTTSERRLSKHSEIVDVLM

superfamily: SSF52058
546-944 SSF52058,LRR

IVDVLMNKAEATKVRGVYLDMFEVKEMGLDSDTFNKMDDLRYLKFYNSHCHRECEAEDSKLNFPEGLEFLPQELRYLNWLKYPEKNLPINFDPKNLIDLKLPYSQIEQIWEEEKDTSNLQWLDLNHSSKLHSLSGLSRAQKLQSINLEGCTGLKTLPQVLQNMESLMFLNLRGCTSLESLPDITLVGLRTLILSNCSRFKEFKLIAKNLEELYLDGTAIKELPSTIGDLQKLISLKLKDCKNLLSLPDSIGNLKAIQEIILSGCSSLESFPEVNQNLKHLKTLLLDGTAIKKIPDILHHLSPDQGLTSSQSNCHLCEWPRGIYGLSSVRRLSLSSNEFRILPRSIGYLYHLNWLDLKHCKNLVSVPMLPPNLQWLDAHGCISLETISILSDPLLAETEH

Gene3D: G3DSA:3.80.10.10
614-731 G3DSA:3.80.10.10

FLPQELRYLNWLKYPEKNLPINFDPKNLIDLKLPYSQIEQIWEEEKDTSNLQWLDLNHSSKLHSLSGLSRAQKLQSINLEGCTGLKTLPQVLQNMESLMFLNLRGCTSLESLPDITLV

HMMPfam: PF07725
IPR011713
640-659 LRR_3
Leucine-rich repeat 3

NLIDLKLPYSQIEQIWEEEK

FPrintScan: PR00364
IPR000767
706-722 DISEASERSIST
Disease resistance protein

QNMESLMFLNLRGCTSL

Gene3D: G3DSA:3.80.10.10
732-955 G3DSA:3.80.10.10

GLRTLILSNCSRFKEFKLIAKNLEELYLDGTAIKELPSTIGDLQKLISLKLKDCKNLLSLPDSIGNLKAIQEIILSGCSSLESFPEVNQNLKHLKTLLLDGTAIKKIPDILHHLSPDQGLTSSQSNCHLCEWPRGIYGLSSVRRLSLSSNEFRILPRSIGYLYHLNWLDLKHCKNLVSVPMLPPNLQWLDAHGCISLETISILSDPLLAETEHLHSTFIFTNCT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox