PRGDB00047062 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18422448 (NM_123818)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G44510) mRNA, complete cds.

DNA Sequence

ATGGATTCTTCATGTTTCTTGGTTTATAGAATATTCAGATTTCGTAAAAGAAATAAGAATATTTCTTCTTCTCTATCTTCTTCATCTCCCCCTTCTTCTTTGTCTCAAAATTGGTTGCACCCTGTTTTCTTGAGCTTCCGTGGGGAAGATGTCCGCAAAGGCTTGCTCAGTCACATTCAGAAGGAGTTTCAAAGAAACGGAATCACACCGTTCATTGATAATGAGATGAAGAGAGGAGGATCCATTGGTCCTGAGCTCTTACAGGCTATTAGAGGATCTAAGATCGCGATCATCTTGCTTTCGAGGAACTATGGTTCTTCGAAGTGGTGTCTTGATGAATTGGTGGAGATTATGAAATGCAGAGAAGAGTTGGGTCAAACAGTGATGACCGTTTTTTATGATGTGGATCCATCTGATGTGAGGAAGCAGAAGGGAGATTTTGGGAAGGTTTTTAAAAAAACTTGTGTTGGAAGACCAGAGGAGATGGTACAGAGATGGAAGCAAGCTTTGACCAGCGCTGCAAATATACTCGGGGAGGATTCTCGCAACTGGGAAAACGAAGCGGATATGATCATTAAAATCTCAAAAGATGTCTCCGATGTGTTGAGTTTTACGCCATCAAAGGATTTTGATGAGTTTGTTGGCATTGAAGCTCATACGACGGAGATAACTTCGTTGTTACAACTTGATCTGGAAGAAGTGAGAATGATAGGGATTTGGGGTCCTGCTGGTATTGGCAAGACGACCATCTCCAGAGTTCTATATAACAAACTCTTTCATCAGTTCCAACTGGGCGCAATCATTGACAACATCAAAGTACGTTATCCAAGACCTTGTCACGATGAGTACAGTGCAAAGCTGCAGTTACAGAAAGAATTGTTGTCTCAGATGATTAACCAGAAAGATATGGTGGTTCCTCATTTAGGTGTTGCCCAAGAGAGGTTGAAGGACAAGAAAGTTCTTCTAGTTCTTGATGACGTCGATGGGTTAGTACAACTTGATGCCATGGCGAAAGATGTACAATGGTTTGGCCTTGGAAGTCGCATTATTGTCGTAACTCAAGATCTAAAACTTTTAAAAGCTCATGGGATCAAGTATATTTACAAAGTTGATTTTCCAACTTCTGATGAGGCTCTTGAAATCTTCTGCATGTATGCTTTTGGTGAGAAGTCCCCTAAAGTTGGTTTTGAGCAGATTGCTCGGACGGTTACAACACTTGCTGGTAAACTCCCGTTAGGACTAAGGGTTATGGGATCATATTTACGGCGAATGTCGAAGCAGGAGTGGGCGAAATCAATACCAAGGCTAAGGACCAGCCTTGACGATGATATTGAGAGCGTTTTGAAGTTCAGTTACAACTCCTTAGCTGAACAAGAGAAAGATTTATTTCTTCACATAACCTGTTTTTTCAGAAGGGAAAGGATTGAGACATTGGAAGTATTTCTTGCAAAGAAGTCTGTAGATATGAGGCAAGGGCTCCAAATCTTGGCAGATAAATCTCTCTTATCTTTGAACTTGGGAAATATAGAGATGCATAATTTGCTAGTACAACTAGGCCTAGACATTGTTCGTAAGCAATCTATTCATAAGCCTGGGAAACGTCAGTTCTTGGTTGATACTGAAGATATTTGTGAAGTACTCACTGATGATACGGGTACCAGAACTCTTATAGGCATAGATCTTGAGTTATCTGGTGTAATCGAGGGCGTAATAAATATTAGTGAAAGAGCCTTTGAAAGAATGTGCAATCTCCAGTTCTTAAGATTCCACCATCCATATGGTGATCGTTGTCACGACATATTGTACTTACCGCAAGGTTTGAGCCATATATCTCGAAAACTTAGACTACTTCATTGGGAACGTTATCCACTGACATGTTTGCCTCCCAAGTTTAATCCGGAGTTCCTTGTCAAAATAAACATGCGAGACAGCATGCTCGAGAAGCTGTGGGACGGAAATGAACCCATTAGAAACCTCAAATGGATGGATTTGAGTTTTTGTGTAAACCTGAAGGAGCTTCCTGATTTCTCTACTGCCACTAATCTCCAAGAATTGAGACTCATAAATTGTTTAAGCTTGGTGGAGCTTCCCTCTTCCATTGGGAATGCCACTAATTTACTGGAATTGGATCTTATTGATTGCTCAAGTCTGGTGAAACTCCCCTCCTCTATTGGGAATCTCACAAATCTAAAAAAGTTGTTTCTCAATAGATGTTCGAGTTTGGTGAAACTCCCTTCCTCTTTTGGGAATGTCACTAGTCTCAAGGAGTTAAATCTCAGTGGTTGTTCAAGTCTTCTGGAGATCCCCTCTTCCATCGGGAATATTGTTAACCTCAAGAAAGTATATGCTGATGGATGTTCAAGTCTGGTGCAACTCCCTTCCTCTATTGGAAATAACACTAATCTCAAGGAATTGCATCTACTGAATTGCTCGAGTTTGATGGAATGCCCTTCTTCTATGTTAAATTTAACTCGTCTCGAAGATTTGAATCTCAGTGGATGCTTAAGTCTGGTGAAGCTCCCCTCTATTGGGAATGTTATTAATCTCCAATCATTGTATCTCAGTGATTGCTCAAGTCTAATGGAACTCCCCTTCACTATTGAGAATGCCACTAATCTCGATACATTGTATCTTGATGGATGCTCGAATCTACTGGAGCTTCCCTCATCTATTTGGAATATCACTAATCTCCAATCATTGTATCTAAACGGATGCTCAAGTCTAAAGGAGCTCCCTTCCTTGGTTGAGAATGCCATTAATCTTCAAAGTTTGTCTCTTATGAAATGTTCAAGTTTGGTAGAGCTCCCTTCCTCCATCTGGAGAATCAGTAATCTCTCATACTTAGATGTCAGTAACTGCTCTAGTTTGCTAGAGCTCAATCTTGTCTCGCACCCCGTGGTTCCAGATTCCCTAATCCTAGATGCAGGAGATTGTGAGTCTCTGGTGCAGAGACTAGATTGCTTCTTTCAAAATCCAAAGATTGTTCTCAACTTCGCTAACTGCTTCAAACTGAATCAAGAAGCAAGAGATCTCATCATCCAGACATCGGCTTGTAGAAATGCGATATTACCAGGTGAAAAAGTGCCTGCATACTTCACGTACCGCGCTACTGGTGATTCTTTAACAGTGAAGTTGAACCAGAAGTATCTTCTTCAATCTTTGAGATTTAAAGCTTGCCTTTTGCTAGTTGAGGGTCAAAACAAATGGCCAAATTGGGGGATGAATCTAGTAACTTCTCGAGAACCAGATGGACACATTGTTCTGTACACACCAAGCAGCCATCTTCAAGGTCCACTTTTAATGGAGAATCTGTATACATTCGAATTTGAACTAGTGGTGACTTCCAGTGAGTTCGTTTTGGAGTTCAGAGCTGATCGTTACAAGTGTGCGTTGGGTCGATTTGACAAGTTTGGTGTGCATGTTGTGTGGTGTCACTTAGACCAGTACGAGTCAAAATCCCCGAGTTGCAAGCCCTTTTGGAGGGATTTTCCTATAGTCATTAGCAATGGTCAGAACATTCTTGATGCTATACTCAAAACTCCAATGCCAAGCATCAATCAGTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MDSSCFLVYRIFRFRKRNKNISSSLSSSSPPSSLSQNWLHPVFLSFRGEDVRKGLLSHIQKEFQRNGITPFIDNEMKRGGSIGPELLQAIRGSKIAIILLSRNYGSSKWCLDELVEIMKCREELGQTVMTVFYDVDPSDVRKQKGDFGKVFKKTCVGRPEEMVQRWKQALTSAANILGEDSRNWENEADMIIKISKDVSDVLSFTPSKDFDEFVGIEAHTTEITSLLQLDLEEVRMIGIWGPAGIGKTTISRVLYNKLFHQFQLGAIIDNIKVRYPRPCHDEYSAKLQLQKELLSQMINQKDMVVPHLGVAQERLKDKKVLLVLDDVDGLVQLDAMAKDVQWFGLGSRIIVVTQDLKLLKAHGIKYIYKVDFPTSDEALEIFCMYAFGEKSPKVGFEQIARTVTTLAGKLPLGLRVMGSYLRRMSKQEWAKSIPRLRTSLDDDIESVLKFSYNSLAEQEKDLFLHITCFFRRERIETLEVFLAKKSVDMRQGLQILADKSLLSLNLGNIEMHNLLVQLGLDIVRKQSIHKPGKRQFLVDTEDICEVLTDDTGTRTLIGIDLELSGVIEGVINISERAFERMCNLQFLRFHHPYGDRCHDILYLPQGLSHISRKLRLLHWERYPLTCLPPKFNPEFLVKINMRDSMLEKLWDGNEPIRNLKWMDLSFCVNLKELPDFSTATNLQELRLINCLSLVELPSSIGNATNLLELDLIDCSSLVKLPSSIGNLTNLKKLFLNRCSSLVKLPSSFGNVTSLKELNLSGCSSLLEIPSSIGNIVNLKKVYADGCSSLVQLPSSIGNNTNLKELHLLNCSSLMECPSSMLNLTRLEDLNLSGCLSLVKLPSIGNVINLQSLYLSDCSSLMELPFTIENATNLDTLYLDGCSNLLELPSSIWNITNLQSLYLNGCSSLKELPSLVENAINLQSLSLMKCSSLVELPSSIWRISNLSYLDVSNCSSLLELNLVSHPVVPDSLILDAGDCESLVQRLDCFFQNPKIVLNFANCFKLNQEARDLIIQTSACRNAILPGEKVPAYFTYRATGDSLTVKLNQKYLLQSLRFKACLLLVEGQNKWPNWGMNLVTSREPDGHIVLYTPSSHLQGPLLMENLYTFEFELVVTSSEFVLEFRADRYKCALGRFDKFGVHVVWCHLDQYESKSPSCKPFWRDFPIVISNGQNILDAILKTPMPSINQ

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
28-179 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSPPSSLSQNWLHPVFLSFRGEDVRKGLLSHIQKEFQRNGITPFIDNEMKRGGSIGPELLQAIRGSKIAIILLSRNYGSSKWCLDELVEIMKCREELGQTVMTVFYDVDPSDVRKQKGDFGKVFKKTCVGRPEEMVQRWKQALTSAANILGE

Gene3D: G3DSA:3.40.50.10140
36-172 G3DSA:3.40.50.10140

QNWLHPVFLSFRGEDVRKGLLSHIQKEFQRNGITPFIDNEMKRGGSIGPELLQAIRGSKIAIILLSRNYGSSKWCLDELVEIMKCREELGQTVMTVFYDVDPSDVRKQKGDFGKVFKKTCVGRPEEMVQRWKQALTS

ProfileScan: PS50104
IPR000157
38-176 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WLHPVFLSFRGEDVRKGLLSHIQKEFQRNGITPFIDNEMKRGGSIGPELLQAIRGSKIAIILLSRNYGSSKWCLDELVEIMKCREELGQTVMTVFYDVDPSDVRKQKGDFGKVFKKTCVGRPEEMVQRWKQALTSAANI

HMMSmart: SM00255
IPR000157
39-176 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LHPVFLSFRGEDVRKGLLSHIQKEFQRNGITPFIDNEMKRGGSIGPELLQAIRGSKIAIILLSRNYGSSKWCLDELVEIMKCREELGQTVMTVFYDVDPSDVRKQKGDFGKVFKKTCVGRPEEMVQRWKQALTSAANI

HMMPfam: PF01582
IPR000157
42-171 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDVRKGLLSHIQKEFQRNGITPFIDNEMKRGGSIGPELLQAIRGSKIAIILLSRNYGSSKWCLDELVEIMKCREELGQTVMTVFYDVDPSDVRKQKGDFGKVFKKTCVGRPEEMVQRWKQALT

HMMPanther: PTHR23155
50-997 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKGLLSHIQKEFQRNGITPFIDNEMKRGGSIGPELLQAIRGSKIAIILLSRNYGSSKWCLDELVEIMKCREELGQTVMTVFYDVDPSDVRKQKGDFGKVFKKTCVGRPEEMVQRWKQALTSAANILGEDSRNWENEADMIIKISKDVSDVLSFTPSKDFDEFVGIEAHTTEITSLLQLDLEEVRMIGIWGPAGIGKTTISRVLYNKLFHQFQLGAIIDNIKVRYPRPCHDEYSAKLQLQKELLSQMINQKDMVVPHLGVAQERLKDKKVLLVLDDVDGLVQLDAMAKDVQWFGLGSRIIVVTQDLKLLKAHGIKYIYKVDFPTSDEALEIFCMYAFGEKSPKVGFEQIARTVTTLAGKLPLGLRVMGSYLRRMSKQEWAKSIPRLRTSLDDDIESVLKFSYNSLAEQEKDLFLHITCFFRRERIETLEVFLAKKSVDMRQGLQILADKSLLSLNLGNIEMHNLLVQLGLDIVRKQSIHKPGKRQFLVDTEDICEVLTDDTGTRTLIGIDLELSGVIEGVINISERAFERMCNLQFLRFHHPYGDRCHDILYLPQGLSHISRKLRLLHWERYPLTCLPPKFNPEFLVKINMRDSMLEKLWDGNEPIRNLKWMDLSFCVNLKELPDFSTATNLQELRLINCLSLVELPSSIGNATNLLELDLIDCSSLVKLPSSIGNLTNLKKLFLNRCSSLVKLPSSFGNVTSLKELNLSGCSSLLEIPSSIGNIVNLKKVYADGCSSLVQLPSSIGNNTNLKELHLLNCSSLMECPSSMLNLTRLEDLNLSGCLSLVKLPSIGNVINLQSLYLSDCSSLMELPFTIENATNLDTLYLDGCSNLLELPSSIWNITNLQSLYLNGCSSLKELPSLVENAINLQSLSLMKCSSLVELPSSIWRISNLSYLDVSNCSSLLELNLVSHPVVPDSLILDAGDCESLVQRLDCFFQNPKIVLN

HMMPanther: PTHR23155:SF301
50-997 PTHR23155:SF301

DVRKGLLSHIQKEFQRNGITPFIDNEMKRGGSIGPELLQAIRGSKIAIILLSRNYGSSKWCLDELVEIMKCREELGQTVMTVFYDVDPSDVRKQKGDFGKVFKKTCVGRPEEMVQRWKQALTSAANILGEDSRNWENEADMIIKISKDVSDVLSFTPSKDFDEFVGIEAHTTEITSLLQLDLEEVRMIGIWGPAGIGKTTISRVLYNKLFHQFQLGAIIDNIKVRYPRPCHDEYSAKLQLQKELLSQMINQKDMVVPHLGVAQERLKDKKVLLVLDDVDGLVQLDAMAKDVQWFGLGSRIIVVTQDLKLLKAHGIKYIYKVDFPTSDEALEIFCMYAFGEKSPKVGFEQIARTVTTLAGKLPLGLRVMGSYLRRMSKQEWAKSIPRLRTSLDDDIESVLKFSYNSLAEQEKDLFLHITCFFRRERIETLEVFLAKKSVDMRQGLQILADKSLLSLNLGNIEMHNLLVQLGLDIVRKQSIHKPGKRQFLVDTEDICEVLTDDTGTRTLIGIDLELSGVIEGVINISERAFERMCNLQFLRFHHPYGDRCHDILYLPQGLSHISRKLRLLHWERYPLTCLPPKFNPEFLVKINMRDSMLEKLWDGNEPIRNLKWMDLSFCVNLKELPDFSTATNLQELRLINCLSLVELPSSIGNATNLLELDLIDCSSLVKLPSSIGNLTNLKKLFLNRCSSLVKLPSSFGNVTSLKELNLSGCSSLLEIPSSIGNIVNLKKVYADGCSSLVQLPSSIGNNTNLKELHLLNCSSLMECPSSMLNLTRLEDLNLSGCLSLVKLPSIGNVINLQSLYLSDCSSLMELPFTIENATNLDTLYLDGCSNLLELPSSIWNITNLQSLYLNGCSSLKELPSLVENAINLQSLSLMKCSSLVELPSSIWRISNLSYLDVSNCSSLLELNLVSHPVVPDSLILDAGDCESLVQRLDCFFQNPKIVLN

superfamily: SSF52540
93-464 SSF52540

SKIAIILLSRNYGSSKWCLDELVEIMKCREELGQTVMTVFYDVDPSDVRKQKGDFGKVFKKTCVGRPEEMVQRWKQALTSAANILGEDSRNWENEADMIIKISKDVSDVLSFTPSKDFDEFVGIEAHTTEITSLLQLDLEEVRMIGIWGPAGIGKTTISRVLYNKLFHQFQLGAIIDNIKVRYPRPCHDEYSAKLQLQKELLSQMINQKDMVVPHLGVAQERLKDKKVLLVLDDVDGLVQLDAMAKDVQWFGLGSRIIVVTQDLKLLKAHGIKYIYKVDFPTSDEALEIFCMYAFGEKSPKVGFEQIARTVTTLAGKLPLGLRVMGSYLRRMSKQEWAKSIPRLRTSLDDDIESVLKFSYNSLAEQEKDLFL

Gene3D: G3DSA:3.40.50.300
205-247 G3DSA:3.40.50.300

TPSKDFDEFVGIEAHTTEITSLLQLDLEEVRMIGIWGPAGIGK

HMMPfam: PF00931
IPR002182
217-478 NB-ARC,NBS
NB-ARC

EAHTTEITSLLQLDLEEVRMIGIWGPAGIGKTTISRVLYNKLFHQFQLGAIIDNIKVRYPRPCHDEYSAKLQLQKELLSQMINQKDMVVPHLGVAQERLKDKKVLLVLDDVDGLVQLDAMAKDVQWFGLGSRIIVVTQDLKLLKAHGIKYIYKVDFPTSDEALEIFCMYAFGEKSPKVGFEQIARTVTTLAGKLPLGLRVMGSYLRRMSKQEWAKSIPRLRTSLDDDIESVLKFSYNSLAEQEKDLFLHITCFFRRERIETL

FPrintScan: PR00364
IPR000767
236-251 DISEASERSIST
Disease resistance protein

MIGIWGPAGIGKTTIS

Gene3D: G3DSA:3.40.50.300
248-411 G3DSA:3.40.50.300

TTISRVLYNKLFHQFQLGAIIDNIKVRYPRPCHDEYSAKLQLQKELLSQMINQKDMVVPHLGVAQERLKDKKVLLVLDDVDGLVQLDAMAKDVQWFGLGSRIIVVTQDLKLLKAHGIKYIYKVDFPTSDEALEIFCMYAFGEKSPKVGFEQIARTVTTLAGKLP

FPrintScan: PR00364
IPR000767
314-328 DISEASERSIST
Disease resistance protein

RLKDKKVLLVLDDVD

FPrintScan: PR00364
IPR000767
407-421 DISEASERSIST
Disease resistance protein

AGKLPLGLRVMGSYL

superfamily: SSF46785
442-548 SSF46785

DDIESVLKFSYNSLAEQEKDLFLHITCFFRRERIETLEVFLAKKSVDMRQGLQILADKSLLSLNLGNIEMHNLLVQLGLDIVRKQSIHKPGKRQFLVDTEDICEVLT

superfamily: SSF52058
561-976 SSF52058,LRR

LELSGVIEGVINISERAFERMCNLQFLRFHHPYGDRCHDILYLPQGLSHISRKLRLLHWERYPLTCLPPKFNPEFLVKINMRDSMLEKLWDGNEPIRNLKWMDLSFCVNLKELPDFSTATNLQELRLINCLSLVELPSSIGNATNLLELDLIDCSSLVKLPSSIGNLTNLKKLFLNRCSSLVKLPSSFGNVTSLKELNLSGCSSLLEIPSSIGNIVNLKKVYADGCSSLVQLPSSIGNNTNLKELHLLNCSSLMECPSSMLNLTRLEDLNLSGCLSLVKLPSIGNVINLQSLYLSDCSSLMELPFTIENATNLDTLYLDGCSNLLELPSSIWNITNLQSLYLNGCSSLKELPSLVENAINLQSLSLMKCSSLVELPSSIWRISNLSYLDVSNCSSLLELNLVSHPVVPDSLILDAG

Gene3D: G3DSA:3.80.10.10
609-825 G3DSA:3.80.10.10

HISRKLRLLHWERYPLTCLPPKFNPEFLVKINMRDSMLEKLWDGNEPIRNLKWMDLSFCVNLKELPDFSTATNLQELRLINCLSLVELPSSIGNATNLLELDLIDCSSLVKLPSSIGNLTNLKKLFLNRCSSLVKLPSSFGNVTSLKELNLSGCSSLLEIPSSIGNIVNLKKVYADGCSSLVQLPSSIGNNTNLKELHLLNCSSLMECPSSMLNLTR

HMMPfam: PF07725
IPR011713
635-653 LRR_3
Leucine-rich repeat 3

FLVKINMRDSMLEKLWDGN

HMMPfam: PF00560
IPR001611
658-677 LRR_1
Leucine-rich repeat

NLKWMDLSFCVNLKELPDFS

HMMPfam: PF13855
728-786 LRR_8,Leucine rich repeat

TNLKKLFLNRCSSLVKLPSSFGNVTSLKELNLSGCSSLLEIPSSIGNIVNLKKVYADGC

FPrintScan: PR00364
IPR000767
749-765 DISEASERSIST
Disease resistance protein

GNVTSLKELNLSGCSSL

HMMPfam: PF00560
IPR001611
825-845 LRR_1
Leucine-rich repeat

RLEDLNLSGCLSLVKLPSIGN

Gene3D: G3DSA:3.80.10.10
826-966 G3DSA:3.80.10.10

LEDLNLSGCLSLVKLPSIGNVINLQSLYLSDCSSLMELPFTIENATNLDTLYLDGCSNLLELPSSIWNITNLQSLYLNGCSSLKELPSLVENAINLQSLSLMKCSSLVELPSSIWRISNLSYLDVSNCSSLLELNLVSHPV

HMMPfam: PF00560
IPR001611
896-913 LRR_1
Leucine-rich repeat

NLQSLYLNGCSSLKELPS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox