PRGDB00047063 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18421747 (NM_123195)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G38340) mRNA, complete cds.

DNA Sequence

ATGGATTCTTCTTTTCTCTCTAGTTTTTGTGCTACAGCCATAATTTTCTTCACGCTTTTCGGTACAATATATTTCATGTTTTATAGAAAAGTCAAATCCCATCAAGAAAACAAAACAATAGCTTCTTCTTTAGCTCTTCCAACTATTCCATCTTCTTTGTCCCGAAAATACGATGTCTTTCCGAGTTTCCACGGAGCAGATGTTCGCAAAACCTTTCTTTCTCACATGCTAAAAGAGTTCAAACGAAAGGGAATCGTTCCATTCATTGATAATGATATCGACAGGAGCAAGTCTATTGGTCCTGAGCTCGACGAAGCTATCAGAGGATCAAAGATCGCAATCGTCATGCTCTCAAAGAACTATGCTTCTTCATCATGGTGCCTAAACGAGTTGGTGGAGATCACGAAATGTAGAAAAGATTTGAATCAAACAGTGATGACCATTTTCTATGGCGTTGACCCAACAGATGTAAAGAAGCAGACAGGAGAGTTTGGGAAGGTCTTCGAAAGAACTTGTGAAAGTAAAACAGAGGAGCAGGTTAAGACATGGAGAGAAGTTTTGGATGGTGCGGCAACAATCGCTGGAGAGCATTGGCACATCTGGGATAATGAAGCGAGCATGATTGAAAAAATTTCCATTGACGTTTCAAACATTCTTAATCGTTCCTCACCCTCAAGAGATTTTGACGATTTGATTGGGATGGAAGCTCATATGGAAAAAATGAAATCGTTGTTGAGCCTACACTCTAATGAAGTGAAGATGATTGGGATTTGGGGTCCTTCTGGGATTGGGAAGACCACCATTGCAAGAGTCTTATATAACCGTTTTTCTGGCGATTTTGGATTGAGTGTCTTTATGGACAATATTAAAGAGTTGATGCATACAAGACCAGTGGGTTCTGACGATTACAGTGCAAAGTTGCACTTACAGAACCAGTTAATGTCCGAGATAACCAACCATAAGGAGACCAAGATTACTCATTTAGGAGTTGTACCTGATAGGTTGAAGGACAATAAAGTGCTTATTGTCCTTGATAGCATTGATCAATCAATACAACTAGATGCTATCGCAAAAGAAACTCAATGGTTCGGTCCTGGGAGTCGGATTATCATCACAACGCAAGACCAAAAACTTCTGGAGGCACATGACATCAACAATATTTACAAGGTGGAGTTTCCATCAAAATATGAAGCTTTTCAAATCTTTTGTACGTATGCTTTTGGTCAAAATTTCCCTAAAGATGGTTTTGAGAAGCTTGCTTGGGAAGTTACAGACCTTTTAGGTGAACTACCATTGGGACTAAGAGTTATGGGCTCCCACTTCCGAAGAATGTCTAAGGATGATTGGGTAATTGCATTACCAAGGTTAAAGACTCGCCTTGATGCTAATATTCAAAGCATTTTGAAGTTTAGTTACGATGCTTTATCTCCTGAAGATAAAGATTTATTCCTTCATATAGCATGCCTTTTCAACAATGAAGAAATAGTGAAAGTCGAAGATTATCTTGCTTTAGATTTCTTGGATGCGAGGCATGGGCTTCACCTCTTAGCTGAGAAATCTCTCATTGATCTCGAAGGTGTTAACTACAAAGTGCTAAAAATGCATAATCTACTAGAACAATTGGGTAAAGAAATTGTCCGTTATCATCCGGCACACCACTCAATCCGTGAGCCTGAAAAGCGTCAGTTTTTGGTTGATACTAAAGATATTTGTGAAGTACTCGCCGATGGCACGGGTAGTAAAAGTATTAAAGGTATATGTTTCGACTTAGATAACCTATCAGGGAGATTAAATATAAGTGAGAGAGCTTTTGAAGGAATGACTAACCTTAAATTCTTAAGAGTTCTGAGAGACCGAAGCGAGAAGTTGTACTTACCGCAAGGTTTAAATTATCTACCTAAGAAACTTAGATTAATAGAATGGGACTATTTTCCGATGAAAAGTTTGCCTTCAAACTTTTGTACAACGTACCTAGTCAACCTACATATGCGGAAAAGCAAACTTGAGAAGTTATGGGAAGGAAAACAGCCACTTGGTAACCTGAAGTGGATGAATTTAAGTAACTCGAGAAACCTAAAGGAGCTACCTGATCTCTCAACAGCTACTAAACTTCAAGATTTGAATCTCACTAGATGCTCCAGCTTGGTGGAGATTCCTTTCTCTATTGGAAACACCACTAATCTTGAGAAACTGAATCTTGTAATGTGCACTAGCTTGGTGGAGCTGCCCTCCTCTATAGGAAGCCTTCATAAATTGCGGGAGTTGAGATTACGAGGATGCTCAAAGCTAGAGGTTCTTCCCACCAACATCAGCTTGGAATCTCTCGATAACCTTGATATCACTGATTGCTCACTGTTGAAAAGTTTTCCTGATATCTCCACAAACATTAAGCATCTCAGCCTCGCGAGAACTGCAATTAATGAAGTGCCGTCGAGGATCAAGTCATGGTCTCGTCTTCGTTACTTTGTAGTGTCATACAATGAAAACCTCAAGGAATCTCCGCACGCTCTTGATACCATCACAATGTTGTCGTCTAACGATACAAAAATGCAAGAATTACCTCGGTGGGTCAAGAAAATCTCTCGTCTTGAGACGCTTATGCTAGAGGGATGCAAAAACCTGGTAACACTCCCAGAACTTCCGGATTCCTTATCAAACATAGGGGTAATAAATTGCGAGTCACTAGAGAGGCTTGATTGTTCCTTCTACAAACATCCAAATATGTTTATCGGGTTTGTTAACTGCTTGAAGCTGAATAAAGAAGCGAGAGAACTCATCCAGACCAGTAGTAGCACTTGTTCGATCTTACCCGGAAGACGAGTGCCTTCAAACTTCACTTACCGAAAAACTGGAGGTTCCGTGCTTGTCAATTTGAATCAAAGTCCTCTTTCTACAACCTTGGTGTTTAAGGCTTGTGTCTTGCTGGTTAATAAAGATGATAAGAAAAAGGAGGCCAATGGTACGTCATTTCAGGTATATTATCGTATAATGGACAAACGCAAATTGGGTGTTATTGTTCCATGGAGATCTGCACACGGCTTTGTTGTGCCTCCAATTTTGGCGGAGCATTTGCTAACCTTTGAACTTGAAGCGGATGTGAAAACCAACGAGTTTTTCTTCGAGTTCGAAGTCAACCGTTACGAAGTGGTGATAAAAGAATGTGGAGTACTCCAACTCTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MDSSFLSSFCATAIIFFTLFGTIYFMFYRKVKSHQENKTIASSLALPTIPSSLSRKYDVFPSFHGADVRKTFLSHMLKEFKRKGIVPFIDNDIDRSKSIGPELDEAIRGSKIAIVMLSKNYASSSWCLNELVEITKCRKDLNQTVMTIFYGVDPTDVKKQTGEFGKVFERTCESKTEEQVKTWREVLDGAATIAGEHWHIWDNEASMIEKISIDVSNILNRSSPSRDFDDLIGMEAHMEKMKSLLSLHSNEVKMIGIWGPSGIGKTTIARVLYNRFSGDFGLSVFMDNIKELMHTRPVGSDDYSAKLHLQNQLMSEITNHKETKITHLGVVPDRLKDNKVLIVLDSIDQSIQLDAIAKETQWFGPGSRIIITTQDQKLLEAHDINNIYKVEFPSKYEAFQIFCTYAFGQNFPKDGFEKLAWEVTDLLGELPLGLRVMGSHFRRMSKDDWVIALPRLKTRLDANIQSILKFSYDALSPEDKDLFLHIACLFNNEEIVKVEDYLALDFLDARHGLHLLAEKSLIDLEGVNYKVLKMHNLLEQLGKEIVRYHPAHHSIREPEKRQFLVDTKDICEVLADGTGSKSIKGICFDLDNLSGRLNISERAFEGMTNLKFLRVLRDRSEKLYLPQGLNYLPKKLRLIEWDYFPMKSLPSNFCTTYLVNLHMRKSKLEKLWEGKQPLGNLKWMNLSNSRNLKELPDLSTATKLQDLNLTRCSSLVEIPFSIGNTTNLEKLNLVMCTSLVELPSSIGSLHKLRELRLRGCSKLEVLPTNISLESLDNLDITDCSLLKSFPDISTNIKHLSLARTAINEVPSRIKSWSRLRYFVVSYNENLKESPHALDTITMLSSNDTKMQELPRWVKKISRLETLMLEGCKNLVTLPELPDSLSNIGVINCESLERLDCSFYKHPNMFIGFVNCLKLNKEARELIQTSSSTCSILPGRRVPSNFTYRKTGGSVLVNLNQSPLSTTLVFKACVLLVNKDDKKKEANGTSFQVYYRIMDKRKLGVIVPWRSAHGFVVPPILAEHLLTFELEADVKTNEFFFEFEVNRYEVVIKECGVLQL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
45-196 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ALPTIPSSLSRKYDVFPSFHGADVRKTFLSHMLKEFKRKGIVPFIDNDIDRSKSIGPELDEAIRGSKIAIVMLSKNYASSSWCLNELVEITKCRKDLNQTVMTIFYGVDPTDVKKQTGEFGKVFERTCESKTEEQVKTWREVLDGAATIAGE

Gene3D: G3DSA:3.40.50.10140
55-186 G3DSA:3.40.50.10140

RKYDVFPSFHGADVRKTFLSHMLKEFKRKGIVPFIDNDIDRSKSIGPELDEAIRGSKIAIVMLSKNYASSSWCLNELVEITKCRKDLNQTVMTIFYGVDPTDVKKQTGEFGKVFERTCESKTEEQVKTWREV

ProfileScan: PS50104
IPR000157
55-193 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RKYDVFPSFHGADVRKTFLSHMLKEFKRKGIVPFIDNDIDRSKSIGPELDEAIRGSKIAIVMLSKNYASSSWCLNELVEITKCRKDLNQTVMTIFYGVDPTDVKKQTGEFGKVFERTCESKTEEQVKTWREVLDGAATI

HMMSmart: SM00255
IPR000157
56-193 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFPSFHGADVRKTFLSHMLKEFKRKGIVPFIDNDIDRSKSIGPELDEAIRGSKIAIVMLSKNYASSSWCLNELVEITKCRKDLNQTVMTIFYGVDPTDVKKQTGEFGKVFERTCESKTEEQVKTWREVLDGAATI

HMMPfam: PF01582
IPR000157
59-187 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRKTFLSHMLKEFKRKGIVPFIDNDIDRSKSIGPELDEAIRGSKIAIVMLSKNYASSSWCLNELVEITKCRKDLNQTVMTIFYGVDPTDVKKQTGEFGKVFERTCESKTEEQVKTWREVL

HMMPanther: PTHR11017:SF20
80-1059 PTHR11017:SF20,SUBFAMILY NOT NAMED

FKRKGIVPFIDNDIDRSKSIGPELDEAIRGSKIAIVMLSKNYASSSWCLNELVEITKCRKDLNQTVMTIFYGVDPTDVKKQTGEFGKVFERTCESKTEEQVKTWREVLDGAATIAGEHWHIWDNEASMIEKISIDVSNILNRSSPSRDFDDLIGMEAHMEKMKSLLSLHSNEVKMIGIWGPSGIGKTTIARVLYNRFSGDFGLSVFMDNIKELMHTRPVGSDDYSAKLHLQNQLMSEITNHKETKITHLGVVPDRLKDNKVLIVLDSIDQSIQLDAIAKETQWFGPGSRIIITTQDQKLLEAHDINNIYKVEFPSKYEAFQIFCTYAFGQNFPKDGFEKLAWEVTDLLGELPLGLRVMGSHFRRMSKDDWVIALPRLKTRLDANIQSILKFSYDALSPEDKDLFLHIACLFNNEEIVKVEDYLALDFLDARHGLHLLAEKSLIDLEGVNYKVLKMHNLLEQLGKEIVRYHPAHHSIREPEKRQFLVDTKDICEVLADGTGSKSIKGICFDLDNLSGRLNISERAFEGMTNLKFLRVLRDRSEKLYLPQGLNYLPKKLRLIEWDYFPMKSLPSNFCTTYLVNLHMRKSKLEKLWEGKQPLGNLKWMNLSNSRNLKELPDLSTATKLQDLNLTRCSSLVEIPFSIGNTTNLEKLNLVMCTSLVELPSSIGSLHKLRELRLRGCSKLEVLPTNISLESLDNLDITDCSLLKSFPDISTNIKHLSLARTAINEVPSRIKSWSRLRYFVVSYNENLKESPHALDTITMLSSNDTKMQELPRWVKKISRLETLMLEGCKNLVTLPELPDSLSNIGVINCESLERLDCSFYKHPNMFIGFVNCLKLNKEARELIQTSSSTCSILPGRRVPSNFTYRKTGGSVLVNLNQSPLSTTLVFKACVLLVNKDDKKKEANGTSFQVYYRIMDKRKLGVIVPWRSAHGFVVPPILAEHLLTFELEADVKTNEFFFEFEVNRYEVVIKECGVLQL

HMMPanther: PTHR11017
80-1059 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FKRKGIVPFIDNDIDRSKSIGPELDEAIRGSKIAIVMLSKNYASSSWCLNELVEITKCRKDLNQTVMTIFYGVDPTDVKKQTGEFGKVFERTCESKTEEQVKTWREVLDGAATIAGEHWHIWDNEASMIEKISIDVSNILNRSSPSRDFDDLIGMEAHMEKMKSLLSLHSNEVKMIGIWGPSGIGKTTIARVLYNRFSGDFGLSVFMDNIKELMHTRPVGSDDYSAKLHLQNQLMSEITNHKETKITHLGVVPDRLKDNKVLIVLDSIDQSIQLDAIAKETQWFGPGSRIIITTQDQKLLEAHDINNIYKVEFPSKYEAFQIFCTYAFGQNFPKDGFEKLAWEVTDLLGELPLGLRVMGSHFRRMSKDDWVIALPRLKTRLDANIQSILKFSYDALSPEDKDLFLHIACLFNNEEIVKVEDYLALDFLDARHGLHLLAEKSLIDLEGVNYKVLKMHNLLEQLGKEIVRYHPAHHSIREPEKRQFLVDTKDICEVLADGTGSKSIKGICFDLDNLSGRLNISERAFEGMTNLKFLRVLRDRSEKLYLPQGLNYLPKKLRLIEWDYFPMKSLPSNFCTTYLVNLHMRKSKLEKLWEGKQPLGNLKWMNLSNSRNLKELPDLSTATKLQDLNLTRCSSLVEIPFSIGNTTNLEKLNLVMCTSLVELPSSIGSLHKLRELRLRGCSKLEVLPTNISLESLDNLDITDCSLLKSFPDISTNIKHLSLARTAINEVPSRIKSWSRLRYFVVSYNENLKESPHALDTITMLSSNDTKMQELPRWVKKISRLETLMLEGCKNLVTLPELPDSLSNIGVINCESLERLDCSFYKHPNMFIGFVNCLKLNKEARELIQTSSSTCSILPGRRVPSNFTYRKTGGSVLVNLNQSPLSTTLVFKACVLLVNKDDKKKEANGTSFQVYYRIMDKRKLGVIVPWRSAHGFVVPPILAEHLLTFELEADVKTNEFFFEFEVNRYEVVIKECGVLQL

superfamily: SSF52540
110-484 SSF52540

SKIAIVMLSKNYASSSWCLNELVEITKCRKDLNQTVMTIFYGVDPTDVKKQTGEFGKVFERTCESKTEEQVKTWREVLDGAATIAGEHWHIWDNEASMIEKISIDVSNILNRSSPSRDFDDLIGMEAHMEKMKSLLSLHSNEVKMIGIWGPSGIGKTTIARVLYNRFSGDFGLSVFMDNIKELMHTRPVGSDDYSAKLHLQNQLMSEITNHKETKITHLGVVPDRLKDNKVLIVLDSIDQSIQLDAIAKETQWFGPGSRIIITTQDQKLLEAHDINNIYKVEFPSKYEAFQIFCTYAFGQNFPKDGFEKLAWEVTDLLGELPLGLRVMGSHFRRMSKDDWVIALPRLKTRLDANIQSILKFSYDALSPEDKDLFL

Gene3D: G3DSA:3.40.50.300
223-264 G3DSA:3.40.50.300

SPSRDFDDLIGMEAHMEKMKSLLSLHSNEVKMIGIWGPSGIG

HMMPfam: PF00931
IPR002182
235-497 NB-ARC,NBS
NB-ARC

EAHMEKMKSLLSLHSNEVKMIGIWGPSGIGKTTIARVLYNRFSGDFGLSVFMDNIKELMHTRPVGSDDYSAKLHLQNQLMSEITNHKETKITHLGVVPDRLKDNKVLIVLDSIDQSIQLDAIAKETQWFGPGSRIIITTQDQKLLEAHDINNIYKVEFPSKYEAFQIFCTYAFGQNFPKDGFEKLAWEVTDLLGELPLGLRVMGSHFRRMSKDDWVIALPRLKTRLDANIQSILKFSYDALSPEDKDLFLHIACLFNNEEIVK

HMMSmart: SM00382
IPR003593
251-397 AAA,NBS
AAA+ ATPase domain

EVKMIGIWGPSGIGKTTIARVLYNRFSGDFGLSVFMDNIKELMHTRPVGSDDYSAKLHLQNQLMSEITNHKETKITHLGVVPDRLKDNKVLIVLDSIDQSIQLDAIAKETQWFGPGSRIIITTQDQKLLEAHDINNIYKVEFPSKYE

FPrintScan: PR00364
IPR000767
254-269 DISEASERSIST
Disease resistance protein

MIGIWGPSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
265-402 G3DSA:3.40.50.300

KTTIARVLYNRFSGDFGLSVFMDNIKELMHTRPVGSDDYSAKLHLQNQLMSEITNHKETKITHLGVVPDRLKDNKVLIVLDSIDQSIQLDAIAKETQWFGPGSRIIITTQDQKLLEAHDINNIYKVEFPSKYEAFQIF

FPrintScan: PR00364
IPR000767
334-348 DISEASERSIST
Disease resistance protein

RLKDNKVLIVLDSID

FPrintScan: PR00364
IPR000767
427-441 DISEASERSIST
Disease resistance protein

LGELPLGLRVMGSHF

superfamily: SSF52058
533-949 SSF52058,LRR

KMHNLLEQLGKEIVRYHPAHHSIREPEKRQFLVDTKDICEVLADGTGSKSIKGICFDLDNLSGRLNISERAFEGMTNLKFLRVLRDRSEKLYLPQGLNYLPKKLRLIEWDYFPMKSLPSNFCTTYLVNLHMRKSKLEKLWEGKQPLGNLKWMNLSNSRNLKELPDLSTATKLQDLNLTRCSSLVEIPFSIGNTTNLEKLNLVMCTSLVELPSSIGSLHKLRELRLRGCSKLEVLPTNISLESLDNLDITDCSLLKSFPDISTNIKHLSLARTAINEVPSRIKSWSRLRYFVVSYNENLKESPHALDTITMLSSNDTKMQELPRWVKKISRLETLMLEGCKNLVTLPELPDSLSNIGVINCESLERLDCSFYKHPNMFIGFVNCLKLNKEARELIQTSSSTCSILPGRRVPSNFTYRK

Gene3D: G3DSA:3.80.10.10
638-902 G3DSA:3.80.10.10

LIEWDYFPMKSLPSNFCTTYLVNLHMRKSKLEKLWEGKQPLGNLKWMNLSNSRNLKELPDLSTATKLQDLNLTRCSSLVEIPFSIGNTTNLEKLNLVMCTSLVELPSSIGSLHKLRELRLRGCSKLEVLPTNISLESLDNLDITDCSLLKSFPDISTNIKHLSLARTAINEVPSRIKSWSRLRYFVVSYNENLKESPHALDTITMLSSNDTKMQELPRWVKKISRLETLMLEGCKNLVTLPELPDSLSNIGVINCESLERLDCSF

HMMPfam: PF07725
IPR011713
657-676 LRR_3
Leucine-rich repeat 3

YLVNLHMRKSKLEKLWEGKQ

FPrintScan: PR00364
IPR000767
770-786 DISEASERSIST
Disease resistance protein

ISLESLDNLDITDCSLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox