PRGDB00047064 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145359755 (NM_126090)
Gene Class CNL
Domain Type LRR, NBS, LRR, LRR, RPW8, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT5G66910) mRNA, complete cds.

DNA Sequence

ATGGTCGTGGTCGATTGGCTTGGTTTGGGATTAGGCTCTGTTGCTGGAGCTTTGGTCTCGGAAGGTCTGAAAGTTTTGATTTCAGAGGCAAAGAAGGTGTTAGCTTTCAAATCTGTGTCTAACGAGCTCGCATCGACGATGGAGTCATTGCTTCCGGTGATCAAAGAGATCGAATCGATGCAAGATGGTATGGAACTACAAGATCTTAAAGACACGATCGATAAAGCTCTTTTACTGGTTGAGAAGTGTTCACATGTCGAGAAGTGGAATATAATCTTGAAATCGAAGTACACGAGAAAAGTTGAGGAAATCAATAGGAAGATGCTCAAGTTCTGTCAGGTTCAACTTCAGCTTCTTCTCTTTAGGAACCAATTGAAGTCTATGCCTTCCATGGAAGCTATTCTTAACAATTATTTCCAAAACATCAATAAGAAGCTCGACCGTTTGAGTGGTTCTCCTGCTCCTCCGCTTGTTTCGAAGCGTTGTTCTGTTCCCAAGCTTGATAATATGGTTCTGGTTGGATTGGATTGGCCATTGGTGGAGCTGAAGAAGAAACTCCTTGACAATTCCGTGGTTGTGGTGTCTGGTCCTCCTGGTTGTGGGAAGACCACGCTGGTTACTAAGCTTTGTGACGACCCAGAGATCGAAGGAGAATTCAAGAAAATCTTCTATAGCGTTGTGTCGAATACTCCTAATTTCAGGGCCATAGTACAAAACTTACTCCAGGACAACGGTTGCGGAGCAATTACATTTGACGATGATTCTCAAGCAGAAACTGGCTTAAGAGATCTTCTGGAGGAACTCACAAAAGATGGTCGTATATTGTTGGTGTTGGATGATGTGTGGCAGGGATCCGAGTTCTTGCTTCGAAAATTTCAAATTGATTTACCAGATTATAAGATTTTGGTGACTTCTCAGTTTGATTTTACGAGTTTATGGCCCACTTACCATTTGGTACCTTTGAAATATGAATATGCTAGGTCCCTTCTCATTCAGTGGGCATCTCCACCTCTTCACACATCTCCAGATGAGTATGAAGATCTTCTCCAAAAGATATTGAAACGTTGCAATGGATTCCCTCTCGTAATTGAAGTAGTCGGCATTTCACTTAAAGGACAAGCTCTGTATTTATGGAAAGGTCAAGTGGAAAGCTGGTCTGAAGGGGAAACAATTCTTGGTAACGCTAATCCTACTGTGCGACAACGTCTGCAGCCTAGCTTCAATGTCCTGAAACCTCATCTTAAAGAGTGTTTCATGGACATGGGTTCATTTCTTCAGGACCAAAAGATACGTGCTTCGCTTATAATTGACATATGGATGGAATTATATGGTAGAGGTAGTTCTAGTACTAACAAGTTCATGTTATACCTTAATGAGCTTGCTTCCCAGAATCTGCTTAAACTTGTTCATCTCGGGACAAATAAGCGCGAAGACGGTTTTTACAATGAGTTGTTAGTCACTCAACATAATATTCTGAGGGAGTTGGCTATTTTTCAAAGTGAATTGGAACCAATCATGCAAAGAAAGAAACTAAATTTGGAGATACGAGAGGACAACTTTCCGGACGAGTGTTTAAATCAACCTATTAATGCTCGACTTTTGTCTATCTATACGGATGATTTGTTCTCATCGAAATGGTTGGAAATGGATTGCCCCAATGTTGAGGCTTTAGTTCTTAATATCTCCTCATTAGACTATGCATTGCCAAGCTTCATTGCTGAAATGAAGAAGCTAAAGGTTCTGACAATCGCAAATCACGGTTTTTATCCAGCAAGATTGAGTAATTTCTCGTGTCTCAGCTCATTACCAAACCTGAAACGGATTAGATTTGAAAAGGTTTCAGTCACTTTGCTGGACATTCCTCAATTGCAACTCGGCAGTCTCAAGAAGCTATCATTTTTCATGTGTAGTTTCGGTGAGGTTTTCTACGACACAGAAGATATAGATGTCTCTAAAGCTCTATCGAATTTACAAGAGATTGACATAGACTACTGCTATGATCTTGATGAGTTACCATATTGGATCCCCGAAGTTGTTTCATTGAAGACACTTAGCATCACAAACTGTAACAAGCTCTCTCAACTTCCAGAAGCTATAGGGAACTTGAGTAGACTAGAAGTGTTGAGGATGTGTTCTTGTATGAATCTCTCTGAGCTGCCTGAAGCAACTGAGAGACTCAGCAACTTGCGGTCTCTGGATATTTCTCATTGCTTAGGATTGAGAAAGTTGCCTCAAGAGATTGGCAAACTACAGAAACTGGAGAATATCTCGATGAGGAAGTGTTCGGGATGCGAGTTGCCGGATTCAGTGAGGTATCTAGAGAATCTGGAGGTCAAATGCGATGAAGTAACTGGATTGTTGTGGGAAAGGTTGATGCCAGAAATGAGAAATTTGAGAGTTCACACGGAGGAAACAGAGCATAACCTGAAGTTGCTTCTAACGTTTTAA


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MVVVDWLGLGLGSVAGALVSEGLKVLISEAKKVLAFKSVSNELASTMESLLPVIKEIESMQDGMELQDLKDTIDKALLLVEKCSHVEKWNIILKSKYTRKVEEINRKMLKFCQVQLQLLLFRNQLKSMPSMEAILNNYFQNINKKLDRLSGSPAPPLVSKRCSVPKLDNMVLVGLDWPLVELKKKLLDNSVVVVSGPPGCGKTTLVTKLCDDPEIEGEFKKIFYSVVSNTPNFRAIVQNLLQDNGCGAITFDDDSQAETGLRDLLEELTKDGRILLVLDDVWQGSEFLLRKFQIDLPDYKILVTSQFDFTSLWPTYHLVPLKYEYARSLLIQWASPPLHTSPDEYEDLLQKILKRCNGFPLVIEVVGISLKGQALYLWKGQVESWSEGETILGNANPTVRQRLQPSFNVLKPHLKECFMDMGSFLQDQKIRASLIIDIWMELYGRGSSSTNKFMLYLNELASQNLLKLVHLGTNKREDGFYNELLVTQHNILRELAIFQSELEPIMQRKKLNLEIREDNFPDECLNQPINARLLSIYTDDLFSSKWLEMDCPNVEALVLNISSLDYALPSFIAEMKKLKVLTIANHGFYPARLSNFSCLSSLPNLKRIRFEKVSVTLLDIPQLQLGSLKKLSFFMCSFGEVFYDTEDIDVSKALSNLQEIDIDYCYDLDELPYWIPEVVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRMCSCMNLSELPEATERLSNLRSLDISHCLGLRKLPQEIGKLQKLENISMRKCSGCELPDSVRYLENLEVKCDEVTGLLWERLMPEMRNLRVHTEETEHNLKLLLTF

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-150 RPW8
Powdery mildew resistance protein, RPW8 domain

MVVVDWLGLGLGSVAGALVSEGLKVLISEAKKVLAFKSVSNELASTMESLLPVIKEIESMQDGMELQDLKDTIDKALLLVEKCSHVEKWNIILKSKYTRKVEEINRKMLKFCQVQLQLLLFRNQLKSMPSMEAILNNYFQNINKKLDRLS

HMMPfam: PF05659
IPR008808
12-133 RPW8
Powdery mildew resistance protein, RPW8 domain

GSVAGALVSEGLKVLISEAKKVLAFKSVSNELASTMESLLPVIKEIESMQDGMELQDLKDTIDKALLLVEKCSHVEKWNIILKSKYTRKVEEINRKMLKFCQVQLQLLLFRNQLKSMPSMEA

HMMPanther: PTHR23155
13-778 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SVAGALVSEGLKVLISEAKKVLAFKSVSNELASTMESLLPVIKEIESMQDGMELQDLKDTIDKALLLVEKCSHVEKWNIILKSKYTRKVEEINRKMLKFCQVQLQLLLFRNQLKSMPSMEAILNNYFQNINKKLDRLSGSPAPPLVSKRCSVPKLDNMVLVGLDWPLVELKKKLLDNSVVVVSGPPGCGKTTLVTKLCDDPEIEGEFKKIFYSVVSNTPNFRAIVQNLLQDNGCGAITFDDDSQAETGLRDLLEELTKDGRILLVLDDVWQGSEFLLRKFQIDLPDYKILVTSQFDFTSLWPTYHLVPLKYEYARSLLIQWASPPLHTSPDEYEDLLQKILKRCNGFPLVIEVVGISLKGQALYLWKGQVESWSEGETILGNANPTVRQRLQPSFNVLKPHLKECFMDMGSFLQDQKIRASLIIDIWMELYGRGSSSTNKFMLYLNELASQNLLKLVHLGTNKREDGFYNELLVTQHNILRELAIFQSELEPIMQRKKLNLEIREDNFPDECLNQPINARLLSIYTDDLFSSKWLEMDCPNVEALVLNISSLDYALPSFIAEMKKLKVLTIANHGFYPARLSNFSCLSSLPNLKRIRFEKVSVTLLDIPQLQLGSLKKLSFFMCSFGEVFYDTEDIDVSKALSNLQEIDIDYCYDLDELPYWIPEVVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRMCSCMNLSELPEATERLSNLRSLDISHCLGLRKLPQEIGKLQKLENISMRKCSGCELPDSVRYLENLEV

HMMPanther: PTHR23155:SF237
13-778 PTHR23155:SF237,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

SVAGALVSEGLKVLISEAKKVLAFKSVSNELASTMESLLPVIKEIESMQDGMELQDLKDTIDKALLLVEKCSHVEKWNIILKSKYTRKVEEINRKMLKFCQVQLQLLLFRNQLKSMPSMEAILNNYFQNINKKLDRLSGSPAPPLVSKRCSVPKLDNMVLVGLDWPLVELKKKLLDNSVVVVSGPPGCGKTTLVTKLCDDPEIEGEFKKIFYSVVSNTPNFRAIVQNLLQDNGCGAITFDDDSQAETGLRDLLEELTKDGRILLVLDDVWQGSEFLLRKFQIDLPDYKILVTSQFDFTSLWPTYHLVPLKYEYARSLLIQWASPPLHTSPDEYEDLLQKILKRCNGFPLVIEVVGISLKGQALYLWKGQVESWSEGETILGNANPTVRQRLQPSFNVLKPHLKECFMDMGSFLQDQKIRASLIIDIWMELYGRGSSSTNKFMLYLNELASQNLLKLVHLGTNKREDGFYNELLVTQHNILRELAIFQSELEPIMQRKKLNLEIREDNFPDECLNQPINARLLSIYTDDLFSSKWLEMDCPNVEALVLNISSLDYALPSFIAEMKKLKVLTIANHGFYPARLSNFSCLSSLPNLKRIRFEKVSVTLLDIPQLQLGSLKKLSFFMCSFGEVFYDTEDIDVSKALSNLQEIDIDYCYDLDELPYWIPEVVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRMCSCMNLSELPEATERLSNLRSLDISHCLGLRKLPQEIGKLQKLENISMRKCSGCELPDSVRYLENLEV

superfamily: SSF52540
155-384 SSF52540

PPLVSKRCSVPKLDNMVLVGLDWPLVELKKKLLDNSVVVVSGPPGCGKTTLVTKLCDDPEIEGEFKKIFYSVVSNTPNFRAIVQNLLQDNGCGAITFDDDSQAETGLRDLLEELTKDGRILLVLDDVWQGSEFLLRKFQIDLPDYKILVTSQFDFTSLWPTYHLVPLKYEYARSLLIQWASPPLHTSPDEYEDLLQKILKRCNGFPLVIEVVGISLKGQALYLWKGQVES

Gene3D: G3DSA:3.40.50.300
171-202 G3DSA:3.40.50.300

VLVGLDWPLVELKKKLLDNSVVVVSGPPGCGK

HMMPfam: PF00931
IPR002182
183-441 NB-ARC,NBS
NB-ARC

KKKLLDNSVVVVSGPPGCGKTTLVTKLCDDPEIEGEFKKIFYSVVSNTPNFRAIVQNLLQDNGCGAITFDDDSQAETGLRDLLEELTKDGRILLVLDDVWQGSEFLLRKFQIDLPDYKILVTSQFDFTSLWPTYHLVPLKYEYARSLLIQWASPPLHTSPDEYEDLLQKILKRCNGFPLVIEVVGISLKGQALYLWKGQVESWSEGETILGNANPTVRQRLQPSFNVLKPHLKECFMDMGSFLQDQKIRASLIIDIWME

FPrintScan: PR00364
IPR000767
191-206 DISEASERSIST
Disease resistance protein

VVVVSGPPGCGKTTLV

Gene3D: G3DSA:3.40.50.300
203-281 G3DSA:3.40.50.300

TTLVTKLCDDPEIEGEFKKIFYSVVSNTPNFRAIVQNLLQDNGCGAITFDDDSQAETGLRDLLEELTKDGRILLVLDDV

FPrintScan: PR00364
IPR000767
268-282 DISEASERSIST
Disease resistance protein

LTKDGRILLVLDDVW

FPrintScan: PR00364
IPR000767
356-370 DISEASERSIST
Disease resistance protein

CNGFPLVIEVVGISL

Gene3D: G3DSA:3.80.10.10
550-777 G3DSA:3.80.10.10

DCPNVEALVLNISSLDYALPSFIAEMKKLKVLTIANHGFYPARLSNFSCLSSLPNLKRIRFEKVSVTLLDIPQLQLGSLKKLSFFMCSFGEVFYDTEDIDVSKALSNLQEIDIDYCYDLDELPYWIPEVVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRMCSCMNLSELPEATERLSNLRSLDISHCLGLRKLPQEIGKLQKLENISMRKCSGCELPDSVRYLENLE

superfamily: SSF52047
551-778 SSF52047,LRR

CPNVEALVLNISSLDYALPSFIAEMKKLKVLTIANHGFYPARLSNFSCLSSLPNLKRIRFEKVSVTLLDIPQLQLGSLKKLSFFMCSFGEVFYDTEDIDVSKALSNLQEIDIDYCYDLDELPYWIPEVVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRMCSCMNLSELPEATERLSNLRSLDISHCLGLRKLPQEIGKLQKLENISMRKCSGCELPDSVRYLENLEV

FPrintScan: PR00364
IPR000767
724-740 DISEASERSIST
Disease resistance protein

ERLSNLRSLDISHCLGL

HMMPfam: PF00560
IPR001611
728-750 LRR_1
Leucine-rich repeat

NLRSLDISHCLGLRKLPQEIGKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox