PRGDB00047065 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30698262 (NM_126089)
Gene Class CNL
Domain Type LRR, NBS, LRR, LRR, RPW8, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT5G66900) mRNA, complete cds.

DNA Sequence

ATGAACGATTGGGCTAGTTTGGGAATAGGTTCTATTGGGGAAGCTGTGTTTTCCAAGCTCCTGAAAGTTGTGATTGATGAAGCAAAAAAGTTCAAAGCTTTCAAACCCTTGTCCAAGGATCTCGTATCAACAATGGAGATATTGTTTCCGTTAACTCAAAAGATTGATTCGATGCAAAAAGAGCTTGACTTTGGTGTAAAGGAACTAAAGGAACTTAGGGATACGATCGAAAGAGCTGATGTAGCTGTTCGGAAGTTTCCAAGAGTCAAGTGGTACGAGAAATCTAAATATACTAGAAAAATTGAGAGAATCAATAAGGATATGCTTAAGTTCTGTCAGATTGATCTTCAGCTTCTTCAGCATAGGAATCAGTTGACGTTGTTGGGTTTGACGGGAAACCTTGTGAATTCGGTTGATGGTTTAAGTAAAAGAATGGACCTTTTGAGTGTTCCTGCGCCTGTTTTTAGGGATCTTTGTTCGGTTCCCAAGCTTGATAAGGTTATTGTTGGATTGGATTGGCCATTGGGGGAGTTAAAGAAGAGACTCCTTGACGATTCTGTGGTTACTCTTGTGGTTTCTGCTCCTCCTGGTTGCGGGAAAACCACGCTGGTTAGTCGGCTTTGTGACGATCCAGATATCAAAGGGAAGTTCAAGCATATCTTCTTTAATGTTGTGTCAAATACTCCTAACTTTAGGGTAATAGTACAGAATTTACTCCAGCACAACGGTTACAATGCACTTACATTTGAGAATGATTCTCAAGCAGAAGTTGGCTTAAGAAAACTGCTGGAGGAACTTAAAGAAAATGGTCCTATATTGTTGGTGTTGGATGATGTGTGGCGGGGAGCGGATTCTTTCCTTCAGAAATTTCAAATTAAGTTACCAAATTATAAGATTTTGGTGACTTCTCGGTTTGACTTTCCGAGTTTTGATTCCAATTATCGTTTGAAACCTTTGGAAGATGATGATGCTAGAGCCCTTCTCATTCATTGGGCATCGCGACCTTGTAACACGTCTCCTGATGAGTACGAAGATCTCCTCCAGAAGATATTGAAACGTTGCAATGGATTCCCAATCGTAATTGAAGTAGTGGGTGTTTCACTCAAAGGACGATCTCTAAATACATGGAAAGGTCAGGTGGAAAGCTGGTCTGAAGGGGAAAAAATTCTTGGTAAGCCTTATCCAACTGTGCTAGAATGTTTGCAGCCTAGTTTTGATGCTCTGGATCCCAACCTTAAGGAGTGCTTTTTGGACATGGGCTCATTTCTTGAGGACCAAAAGATACGTGCTTCGGTAATAATTGATATGTGGGTGGAATTATACGGTAAAGGTAGTAGTATCTTGTATATGTACCTTGAAGACCTTGCCTCCCAGAATCTACTTAAACTTGTTCCTCTCGGCACAAATGAGCACGAAGACGGTTTCTACAATGACTTCTTAGTGACTCAACATGATATCCTTAGGGAGTTGGCTATCTGTCAAAGCGAATTTAAGGAAAACTTAGAAAGAAAAAGACTAAATCTGGAGATACTAGAGAATACATTTCCAGACTGGTGTTTGAATACTATTAATGCCTCTTTATTGTCTATCTCTACGGATGATTTGTTCTCATCGAAATGGTTGGAAATGGATTGCCCCAATGTTGAGGCTTTAGTTCTAAATCTCTCTTCATCAGACTATGCATTGCCAAGCTTCATCTCTGGAATGAAGAAGCTGAAGGTTCTGACAATCACAAATCACGGTTTTTATCCAGCAAGATTGAGTAATTTCTCGTGTCTCAGCTCATTACCAAACCTGAAACGGATTAGATTGGAAAAAGTTTCAATCACTTTGCTAGACATTCCCCAACTGCAACTCAGCAGTCTTAAGAAGCTGTCTTTGGTCATGTGTAGTTTCGGTGAGGTTTTCTACGACACAGAAGATATAGTTGTCTCTAATGCTCTATCGAAATTACAAGAGATTGACATAGACTACTGCTATGATCTTGATGAGTTACCGTATTGGATCTCTGAAATTGTTTCATTGAAGACACTTAGCATCACAAACTGTAACAAGCTCTCTCAACTTCCAGAAGCTATAGGCAACTTGAGTAGACTAGAAGTGTTGAGGCTGTGTTCTTCTATGAATCTCTCTGAGCTGCCTGAAGCGACTGAGGGACTCAGCAACTTGCGGTTTCTGGATATTTCTCATTGCTTAGGATTGAGAAAGTTGCCTCAAGAGATTGGCAAACTGCAGAATCTGAAAAAGATCTCGATGAGAAAGTGTTCGGGATGCGAGTTGCCGGAGTCAGTGACGAATCTAGAGAATCTGGAGGTCAAATGCGATGAAGAAACTGGATTGTTGTGGGAAAGGCTGAAGCCAAAAATGAGAAATTTGAGAGTTCAGGAGGAGGAAATAGAGCATAACCTGAACTTGCTTCAAATGTTTTAA


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MNDWASLGIGSIGEAVFSKLLKVVIDEAKKFKAFKPLSKDLVSTMEILFPLTQKIDSMQKELDFGVKELKELRDTIERADVAVRKFPRVKWYEKSKYTRKIERINKDMLKFCQIDLQLLQHRNQLTLLGLTGNLVNSVDGLSKRMDLLSVPAPVFRDLCSVPKLDKVIVGLDWPLGELKKRLLDDSVVTLVVSAPPGCGKTTLVSRLCDDPDIKGKFKHIFFNVVSNTPNFRVIVQNLLQHNGYNALTFENDSQAEVGLRKLLEELKENGPILLVLDDVWRGADSFLQKFQIKLPNYKILVTSRFDFPSFDSNYRLKPLEDDDARALLIHWASRPCNTSPDEYEDLLQKILKRCNGFPIVIEVVGVSLKGRSLNTWKGQVESWSEGEKILGKPYPTVLECLQPSFDALDPNLKECFLDMGSFLEDQKIRASVIIDMWVELYGKGSSILYMYLEDLASQNLLKLVPLGTNEHEDGFYNDFLVTQHDILRELAICQSEFKENLERKRLNLEILENTFPDWCLNTINASLLSISTDDLFSSKWLEMDCPNVEALVLNLSSSDYALPSFISGMKKLKVLTITNHGFYPARLSNFSCLSSLPNLKRIRLEKVSITLLDIPQLQLSSLKKLSLVMCSFGEVFYDTEDIVVSNALSKLQEIDIDYCYDLDELPYWISEIVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRLCSSMNLSELPEATEGLSNLRFLDISHCLGLRKLPQEIGKLQNLKKISMRKCSGCELPESVTNLENLEVKCDEETGLLWERLKPKMRNLRVQEEEIEHNLNLLQMF

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-150 RPW8
Powdery mildew resistance protein, RPW8 domain

MNDWASLGIGSIGEAVFSKLLKVVIDEAKKFKAFKPLSKDLVSTMEILFPLTQKIDSMQKELDFGVKELKELRDTIERADVAVRKFPRVKWYEKSKYTRKIERINKDMLKFCQIDLQLLQHRNQLTLLGLTGNLVNSVDGLSKRMDLLSV

HMMPanther: PTHR23155
9-772 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IGSIGEAVFSKLLKVVIDEAKKFKAFKPLSKDLVSTMEILFPLTQKIDSMQKELDFGVKELKELRDTIERADVAVRKFPRVKWYEKSKYTRKIERINKDMLKFCQIDLQLLQHRNQLTLLGLTGNLVNSVDGLSKRMDLLSVPAPVFRDLCSVPKLDKVIVGLDWPLGELKKRLLDDSVVTLVVSAPPGCGKTTLVSRLCDDPDIKGKFKHIFFNVVSNTPNFRVIVQNLLQHNGYNALTFENDSQAEVGLRKLLEELKENGPILLVLDDVWRGADSFLQKFQIKLPNYKILVTSRFDFPSFDSNYRLKPLEDDDARALLIHWASRPCNTSPDEYEDLLQKILKRCNGFPIVIEVVGVSLKGRSLNTWKGQVESWSEGEKILGKPYPTVLECLQPSFDALDPNLKECFLDMGSFLEDQKIRASVIIDMWVELYGKGSSILYMYLEDLASQNLLKLVPLGTNEHEDGFYNDFLVTQHDILRELAICQSEFKENLERKRLNLEILENTFPDWCLNTINASLLSISTDDLFSSKWLEMDCPNVEALVLNLSSSDYALPSFISGMKKLKVLTITNHGFYPARLSNFSCLSSLPNLKRIRLEKVSITLLDIPQLQLSSLKKLSLVMCSFGEVFYDTEDIVVSNALSKLQEIDIDYCYDLDELPYWISEIVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRLCSSMNLSELPEATEGLSNLRFLDISHCLGLRKLPQEIGKLQNLKKISMRKCSGCELPESVTNLENLEV

HMMPanther: PTHR23155:SF239
9-772 PTHR23155:SF239,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

IGSIGEAVFSKLLKVVIDEAKKFKAFKPLSKDLVSTMEILFPLTQKIDSMQKELDFGVKELKELRDTIERADVAVRKFPRVKWYEKSKYTRKIERINKDMLKFCQIDLQLLQHRNQLTLLGLTGNLVNSVDGLSKRMDLLSVPAPVFRDLCSVPKLDKVIVGLDWPLGELKKRLLDDSVVTLVVSAPPGCGKTTLVSRLCDDPDIKGKFKHIFFNVVSNTPNFRVIVQNLLQHNGYNALTFENDSQAEVGLRKLLEELKENGPILLVLDDVWRGADSFLQKFQIKLPNYKILVTSRFDFPSFDSNYRLKPLEDDDARALLIHWASRPCNTSPDEYEDLLQKILKRCNGFPIVIEVVGVSLKGRSLNTWKGQVESWSEGEKILGKPYPTVLECLQPSFDALDPNLKECFLDMGSFLEDQKIRASVIIDMWVELYGKGSSILYMYLEDLASQNLLKLVPLGTNEHEDGFYNDFLVTQHDILRELAICQSEFKENLERKRLNLEILENTFPDWCLNTINASLLSISTDDLFSSKWLEMDCPNVEALVLNLSSSDYALPSFISGMKKLKVLTITNHGFYPARLSNFSCLSSLPNLKRIRLEKVSITLLDIPQLQLSSLKKLSLVMCSFGEVFYDTEDIVVSNALSKLQEIDIDYCYDLDELPYWISEIVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRLCSSMNLSELPEATEGLSNLRFLDISHCLGLRKLPQEIGKLQNLKKISMRKCSGCELPESVTNLENLEV

HMMPfam: PF05659
IPR008808
10-133 RPW8
Powdery mildew resistance protein, RPW8 domain

GSIGEAVFSKLLKVVIDEAKKFKAFKPLSKDLVSTMEILFPLTQKIDSMQKELDFGVKELKELRDTIERADVAVRKFPRVKWYEKSKYTRKIERINKDMLKFCQIDLQLLQHRNQLTLLGLTGN

Gene3D: G3DSA:3.80.10.10
100-141 G3DSA:3.80.10.10

KIERINKDMLKFCQIDLQLLQHRNQLTLLGLTGNLVNSVDGL

superfamily: SSF52540
151-382 SSF52540

PAPVFRDLCSVPKLDKVIVGLDWPLGELKKRLLDDSVVTLVVSAPPGCGKTTLVSRLCDDPDIKGKFKHIFFNVVSNTPNFRVIVQNLLQHNGYNALTFENDSQAEVGLRKLLEELKENGPILLVLDDVWRGADSFLQKFQIKLPNYKILVTSRFDFPSFDSNYRLKPLEDDDARALLIHWASRPCNTSPDEYEDLLQKILKRCNGFPIVIEVVGVSLKGRSLNTWKGQVES

HMMPfam: PF00931
IPR002182
176-439 NB-ARC,NBS
NB-ARC

GELKKRLLDDSVVTLVVSAPPGCGKTTLVSRLCDDPDIKGKFKHIFFNVVSNTPNFRVIVQNLLQHNGYNALTFENDSQAEVGLRKLLEELKENGPILLVLDDVWRGADSFLQKFQIKLPNYKILVTSRFDFPSFDSNYRLKPLEDDDARALLIHWASRPCNTSPDEYEDLLQKILKRCNGFPIVIEVVGVSLKGRSLNTWKGQVESWSEGEKILGKPYPTVLECLQPSFDALDPNLKECFLDMGSFLEDQKIRASVIIDMWVE

Gene3D: G3DSA:3.40.50.300
184-281 G3DSA:3.40.50.300

DDSVVTLVVSAPPGCGKTTLVSRLCDDPDIKGKFKHIFFNVVSNTPNFRVIVQNLLQHNGYNALTFENDSQAEVGLRKLLEELKENGPILLVLDDVWR

FPrintScan: PR00364
IPR000767
189-204 DISEASERSIST
Disease resistance protein

TLVVSAPPGCGKTTLV

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

LKENGPILLVLDDVW

FPrintScan: PR00364
IPR000767
354-368 DISEASERSIST
Disease resistance protein

CNGFPIVIEVVGVSL

Gene3D: G3DSA:3.80.10.10
543-652 G3DSA:3.80.10.10

MDCPNVEALVLNLSSSDYALPSFISGMKKLKVLTITNHGFYPARLSNFSCLSSLPNLKRIRLEKVSITLLDIPQLQLSSLKKLSLVMCSFGEVFYDTEDIVVSNALSKLQ

superfamily: SSF52047
561-772 SSF52047,LRR

ALPSFISGMKKLKVLTITNHGFYPARLSNFSCLSSLPNLKRIRLEKVSITLLDIPQLQLSSLKKLSLVMCSFGEVFYDTEDIVVSNALSKLQEIDIDYCYDLDELPYWISEIVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRLCSSMNLSELPEATEGLSNLRFLDISHCLGLRKLPQEIGKLQNLKKISMRKCSGCELPESVTNLENLEV

Gene3D: G3DSA:3.80.10.10
653-793 G3DSA:3.80.10.10

EIDIDYCYDLDELPYWISEIVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRLCSSMNLSELPEATEGLSNLRFLDISHCLGLRKLPQEIGKLQNLKKISMRKCSGCELPESVTNLENLEVKCDEETGLLWERLKPKMRNLR

HMMPfam: PF13855
674-731 LRR_8,Leucine rich repeat

SLKTLSITNCNKLSQLPEAIGNLSRLEVLRLCSSMNLSELPEATEGLSNLRFLDISHC

FPrintScan: PR00364
IPR000767
718-734 DISEASERSIST
Disease resistance protein

EGLSNLRFLDISHCLGL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox