PRGDB00047067 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18422675 (NM_124015)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G46450) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCGTCCTCCTCTTCTCGCAATTGGTCATATGATGTTTTCCCAAGCTTCAGTGGAGAAGATGTCCGCAAAACATTCCTCAGCCACTTTCTCAGGGAGCTGGAACGGAAATCGATCATTACTTTCAAAGACAATGAGATGGAGAGAAGCCAGTCAATAGCCCCAGAGCTTGTAGAGGCGATTAAAGATTCAAGGATTGCAGTGATTGTGTTCTCTAAAAACTACGCCTCTTCAAGCTGGTGTCTAAATGAGCTGTTAGAGATTATGCGATGCAACAAATATTTGGGCCAGCAAGTGATACCAGTCTTCTACTATTTGGATCCTTCTCATCTTCGGAAACAGTCGGGAGAGTTTGGAGAGGCATTTAAAAAGACTTGCCAGAACCAAACTGAGGAAGTGAAAAATCAGTGGAAGCAAGCGTTGACTGATGTTTCAAACATCCTCGGATATCATTCTAAGAACTGCAATAGCGAAGCTACAATGATTGAAGAAATCTCCAGTCATATTTTAGGTAAACTGAGTTTAACTCCATCAAATGATTTTGAGGAATTTGTTGGCATCAAAGATCATATCGAGAAGGTGAGGTTGTTGTTGCATTTGGAATCTGACGAAGTGAGGATGGTTGGGATATGGGGTACCTCGGGAATCGGTAAGACTACCATTGCAAGAGCTTTATTTAGTAATCTCTCTAGTCAGTTTCAAAGTAGTGTTTACATAGACAGGGCTTTCATATCTAAGAGTATGGAAGGTTACGGTCGAGCCAATCCAGATGACTATAACATGAAGTTGCGTTTGCGAGAAAATTTCCTGTTTGAAATTTTGGGCAAAAAGAACATGAAGATCGGTGCAATGGAAGAAAGGCTGAAGCATCAAAAAGTTCTTATCATTATTGATGATTTGGATGATCAAGATGTGCTAGATGCCTTAGTGGGTAGAACTCAATGGTTTGGAAGTGGGAGTAGAATAATTGTGGTTACAAAAAACAAACATTTCTTAAGGGCCCATGGGATTGATCATGTTTACGAGGCCTGTCTCCCATCTGAAGAACTTGCTCTTGAGATGTTTTGTCGATATGCTTTCAGGAAGAATTCTCCACCTGATGGTTTTATGGAGCTTTCTTCTGAAGTTGCATTGCGCGCTGGTAATCTTCCTTTGGGTCTTAAAGTTTTGGGTTCGTATCTACGGGGTAGGGACATAGAGGACTGGATGGATATGATGCCGAGGCTTCAAAATGATTTAGATGGGAAAATTGAGAAGACACTAAGAGTCAGCTACGATGGATTAAACAACAAAAAGGATGAAGCAATATTTCGTCACATTGCATGTCTTTTCAATGGTGAGAAAGTAAATGACATCAAGTTGCTTCTAGCAGAGAGTGACTTGGATGTTAATATTGGGTTAAAAAACCTTGTTGATAAGTCTCTCATATTTGTAAGAGAGGATACTATTGAGATGCACCGTTTGCTACAAGATATGGGTAAGGAGATTGTCCGTGCACAGTCAAATGAGCCTGGAGAACGGGAATTCCTTGTGGATTCGAAGCATATCTACGATGTACTTGAAGATAACACTGGTACTAAAAAAGTCTTAGGTATCGCACTGGATATTAACGAGACTGATGGACTGTATATACATGAGAGTGCCTTCAAAGGGATGCGTAATCTCCTGTTTCTAAATTTTTACACTAAACAGAAGAAAGATGTAACATGGCACTTATCAGAAGGTTTCGATCATTTACCCCCTAAGCTCAGATTACTGAGTTGGGAAAAATACCCGTTGAGATGTATGCCTTCTAACTTTCGTCCAGAAAACCTTGTTAAGCTTCAAATGTGTGAGAGCAAACTCGAAAAGTTGTGGGATGGAGTTCATTCACTTACAGGGCTCAGGAATATGGATTTGCGGGGATCAGAAAACCTGAAAGAAATTCCAGATCTTTCTTTGGCCACTAACCTCAAGAAACTTGATGTTAGCAATTGCACAAGTTTAGTGGAGCTTTCTTCCACAATTCAGAATCTTAATCAATTAGAGGAATTGCAGATGGAACGTTGCGAAAATTTGGAGAATCTTCCCATTGGAATCAACCTCGAATCTCTTTATTGCCTCAATCTCAATGGATGCTCAAAGTTGAGGAGTTTTCCAGATATCTCAACAACTATCTCAGAGCTCTATCTAAGCGAAACAGCCATAGAAGAATTTCCCACTGAGTTGCATTTAGAGAATCTATATTATCTTGGCTTGTATGACATGAAGAGTGAGAAATTGTGGAAAAGAGTGCAGCCGCTTACACCGCTCATGACCATGCTGTCTCCCTCTTTGACGAAGCTATTTCTCTCAGATATCCCAAGTTTGGTGGAGCTTCCTTCTTCATTTCAGAATCTCCATAATCTTGAGCATTTGAACATTGCACGATGCACAAATCTGGAGACTCTTCCCACTGGAGTCAACCTAGAATTACTTGAACAACTTGATTTTTCTGGATGCTCACGGTTGAGGAGTTTTCCTGATATCTCAACCAACATCTTTTCACTAGTTCTAGACGGAACAGGGATTGAAGAGGTTCCTTGGTGGATTGAGGATTTCTATAGGCTCTCTTTCCTGAGTATGATTGGATGCAACAATTTACAAGGTGTGTCCCTAAACATTTCTAAACTGGAAAAACTCGAGACGGTAGACTTTTCAGACTGTGAGGCACTGTCTCATGCTAATTGGGATACCATTCCAAGTGCAGTGGCGATGGCAACAGAAAATATTCACTCTAAGTTACCAGTCTGTATCAAATTCAGCAACTGCTTCAACTTGGATCATAAAGCTGTCCTTCTGCAACAATCAATTTTCAAGCAACTAATCTTGTCAGGTGGAGAAATGTTTTCATATTTCACTCACCGAACTACTGGAACGTCTCTGACCAATATCCCTCTTCTTCACATCTCTCCTTGTCAACCATTCTTCAGATTTAGAGCTTGCGCCTTGGTTGATACTGAATCTATGGACATAGGTAGTGTATTTTTCCAGGTCCAGGTATCTTGTCGGTTCACAGACAGACTCGGGAACTATTTGGATTCCCCTTATCAACACGAGGTCTTCGCAGTACTTGAGAAGGGTAGTCATATGGTTATATCTGACTGCTGTTTCCCTTTTAACGAAGACAATGCTCCTCTAGCTGAACTTATCTATGATCACGTGGATATACAGTTTCACTTTACTCAAGAAAACGATGAGCTCAAACTAATAGGATGTGGTCTAAGACTCTCTGAAGCCGATAATGATCTAGGCAATGAGATTGATGGCAGTGAAGAGTGGGAAGACTGCAACGATAGCGGTCTTGGCAGTGAATCTGATAATTTAGAGGCAGAAGAAGACACGTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSSSSRNWSYDVFPSFSGEDVRKTFLSHFLRELERKSIITFKDNEMERSQSIAPELVEAIKDSRIAVIVFSKNYASSSWCLNELLEIMRCNKYLGQQVIPVFYYLDPSHLRKQSGEFGEAFKKTCQNQTEEVKNQWKQALTDVSNILGYHSKNCNSEATMIEEISSHILGKLSLTPSNDFEEFVGIKDHIEKVRLLLHLESDEVRMVGIWGTSGIGKTTIARALFSNLSSQFQSSVYIDRAFISKSMEGYGRANPDDYNMKLRLRENFLFEILGKKNMKIGAMEERLKHQKVLIIIDDLDDQDVLDALVGRTQWFGSGSRIIVVTKNKHFLRAHGIDHVYEACLPSEELALEMFCRYAFRKNSPPDGFMELSSEVALRAGNLPLGLKVLGSYLRGRDIEDWMDMMPRLQNDLDGKIEKTLRVSYDGLNNKKDEAIFRHIACLFNGEKVNDIKLLLAESDLDVNIGLKNLVDKSLIFVREDTIEMHRLLQDMGKEIVRAQSNEPGEREFLVDSKHIYDVLEDNTGTKKVLGIALDINETDGLYIHESAFKGMRNLLFLNFYTKQKKDVTWHLSEGFDHLPPKLRLLSWEKYPLRCMPSNFRPENLVKLQMCESKLEKLWDGVHSLTGLRNMDLRGSENLKEIPDLSLATNLKKLDVSNCTSLVELSSTIQNLNQLEELQMERCENLENLPIGINLESLYCLNLNGCSKLRSFPDISTTISELYLSETAIEEFPTELHLENLYYLGLYDMKSEKLWKRVQPLTPLMTMLSPSLTKLFLSDIPSLVELPSSFQNLHNLEHLNIARCTNLETLPTGVNLELLEQLDFSGCSRLRSFPDISTNIFSLVLDGTGIEEVPWWIEDFYRLSFLSMIGCNNLQGVSLNISKLEKLETVDFSDCEALSHANWDTIPSAVAMATENIHSKLPVCIKFSNCFNLDHKAVLLQQSIFKQLILSGGEMFSYFTHRTTGTSLTNIPLLHISPCQPFFRFRACALVDTESMDIGSVFFQVQVSCRFTDRLGNYLDSPYQHEVFAVLEKGSHMVISDCCFPFNEDNAPLAELIYDHVDIQFHFTQENDELKLIGCGLRLSEADNDLGNEIDGSEEWEDCNDSGLGSESDNLEAEEDT

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSSSRNWSYDVFPSFSGEDVRKTFLSHFLRELERKSIITFKDNEMERSQSIAPELVEAIKDSRIAVIVFSKNYASSSWCLNELLEIMRCNKYLGQQVIPVFYYLDPSHLRKQSGEFGEAFKKTCQNQTEEVKNQWKQALTDVSNILGY

Gene3D: G3DSA:3.40.50.10140
8-149 G3DSA:3.40.50.10140

SRNWSYDVFPSFSGEDVRKTFLSHFLRELERKSIITFKDNEMERSQSIAPELVEAIKDSRIAVIVFSKNYASSSWCLNELLEIMRCNKYLGQQVIPVFYYLDPSHLRKQSGEFGEAFKKTCQNQTEEVKNQWKQALTDVSNI

ProfileScan: PS50104
IPR000157
11-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WSYDVFPSFSGEDVRKTFLSHFLRELERKSIITFKDNEMERSQSIAPELVEAIKDSRIAVIVFSKNYASSSWCLNELLEIMRCNKYLGQQVIPVFYYLDPSHLRKQSGEFGEAFKKTCQNQTEEVKNQWKQALTDVSNI

HMMSmart: SM00255
IPR000157
12-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SYDVFPSFSGEDVRKTFLSHFLRELERKSIITFKDNEMERSQSIAPELVEAIKDSRIAVIVFSKNYASSSWCLNELLEIMRCNKYLGQQVIPVFYYLDPSHLRKQSGEFGEAFKKTCQNQTEEVKNQWKQALTDVSNI

HMMPfam: PF01582
IPR000157
15-144 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFSGEDVRKTFLSHFLRELERKSIITFKDNEMERSQSIAPELVEAIKDSRIAVIVFSKNYASSSWCLNELLEIMRCNKYLGQQVIPVFYYLDPSHLRKQSGEFGEAFKKTCQNQTEEVKNQWKQALT

HMMPanther: PTHR11017:SF20
35-1122 PTHR11017:SF20,SUBFAMILY NOT NAMED

ELERKSIITFKDNEMERSQSIAPELVEAIKDSRIAVIVFSKNYASSSWCLNELLEIMRCNKYLGQQVIPVFYYLDPSHLRKQSGEFGEAFKKTCQNQTEEVKNQWKQALTDVSNILGYHSKNCNSEATMIEEISSHILGKLSLTPSNDFEEFVGIKDHIEKVRLLLHLESDEVRMVGIWGTSGIGKTTIARALFSNLSSQFQSSVYIDRAFISKSMEGYGRANPDDYNMKLRLRENFLFEILGKKNMKIGAMEERLKHQKVLIIIDDLDDQDVLDALVGRTQWFGSGSRIIVVTKNKHFLRAHGIDHVYEACLPSEELALEMFCRYAFRKNSPPDGFMELSSEVALRAGNLPLGLKVLGSYLRGRDIEDWMDMMPRLQNDLDGKIEKTLRVSYDGLNNKKDEAIFRHIACLFNGEKVNDIKLLLAESDLDVNIGLKNLVDKSLIFVREDTIEMHRLLQDMGKEIVRAQSNEPGEREFLVDSKHIYDVLEDNTGTKKVLGIALDINETDGLYIHESAFKGMRNLLFLNFYTKQKKDVTWHLSEGFDHLPPKLRLLSWEKYPLRCMPSNFRPENLVKLQMCESKLEKLWDGVHSLTGLRNMDLRGSENLKEIPDLSLATNLKKLDVSNCTSLVELSSTIQNLNQLEELQMERCENLENLPIGINLESLYCLNLNGCSKLRSFPDISTTISELYLSETAIEEFPTELHLENLYYLGLYDMKSEKLWKRVQPLTPLMTMLSPSLTKLFLSDIPSLVELPSSFQNLHNLEHLNIARCTNLETLPTGVNLELLEQLDFSGCSRLRSFPDISTNIFSLVLDGTGIEEVPWWIEDFYRLSFLSMIGCNNLQGVSLNISKLEKLETVDFSDCEALSHANWDTIPSAVAMATENIHSKLPVCIKFSNCFNLDHKAVLLQQSIFKQLILSGGEMFSYFTHRTTGTSLTNIPLLHISPCQPFFRFRACALVDTESMDIGSVFFQVQVSCRFTDRLGNYLDSPYQHEVFAVLEKGSHMVISDCCFPFNEDNAPLAELIYDHVDIQFHFTQENDELKLIGCGLRLSEADNDLGNEIDGSEEWEDCNDSGLGSESDNLEAEED

HMMPanther: PTHR11017
35-1122 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ELERKSIITFKDNEMERSQSIAPELVEAIKDSRIAVIVFSKNYASSSWCLNELLEIMRCNKYLGQQVIPVFYYLDPSHLRKQSGEFGEAFKKTCQNQTEEVKNQWKQALTDVSNILGYHSKNCNSEATMIEEISSHILGKLSLTPSNDFEEFVGIKDHIEKVRLLLHLESDEVRMVGIWGTSGIGKTTIARALFSNLSSQFQSSVYIDRAFISKSMEGYGRANPDDYNMKLRLRENFLFEILGKKNMKIGAMEERLKHQKVLIIIDDLDDQDVLDALVGRTQWFGSGSRIIVVTKNKHFLRAHGIDHVYEACLPSEELALEMFCRYAFRKNSPPDGFMELSSEVALRAGNLPLGLKVLGSYLRGRDIEDWMDMMPRLQNDLDGKIEKTLRVSYDGLNNKKDEAIFRHIACLFNGEKVNDIKLLLAESDLDVNIGLKNLVDKSLIFVREDTIEMHRLLQDMGKEIVRAQSNEPGEREFLVDSKHIYDVLEDNTGTKKVLGIALDINETDGLYIHESAFKGMRNLLFLNFYTKQKKDVTWHLSEGFDHLPPKLRLLSWEKYPLRCMPSNFRPENLVKLQMCESKLEKLWDGVHSLTGLRNMDLRGSENLKEIPDLSLATNLKKLDVSNCTSLVELSSTIQNLNQLEELQMERCENLENLPIGINLESLYCLNLNGCSKLRSFPDISTTISELYLSETAIEEFPTELHLENLYYLGLYDMKSEKLWKRVQPLTPLMTMLSPSLTKLFLSDIPSLVELPSSFQNLHNLEHLNIARCTNLETLPTGVNLELLEQLDFSGCSRLRSFPDISTNIFSLVLDGTGIEEVPWWIEDFYRLSFLSMIGCNNLQGVSLNISKLEKLETVDFSDCEALSHANWDTIPSAVAMATENIHSKLPVCIKFSNCFNLDHKAVLLQQSIFKQLILSGGEMFSYFTHRTTGTSLTNIPLLHISPCQPFFRFRACALVDTESMDIGSVFFQVQVSCRFTDRLGNYLDSPYQHEVFAVLEKGSHMVISDCCFPFNEDNAPLAELIYDHVDIQFHFTQENDELKLIGCGLRLSEADNDLGNEIDGSEEWEDCNDSGLGSESDNLEAEED

superfamily: SSF52540
66-428 SSF52540

SRIAVIVFSKNYASSSWCLNELLEIMRCNKYLGQQVIPVFYYLDPSHLRKQSGEFGEAFKKTCQNQTEEVKNQWKQALTDVSNILGYHSKNCNSEATMIEEISSHILGKLSLTPSNDFEEFVGIKDHIEKVRLLLHLESDEVRMVGIWGTSGIGKTTIARALFSNLSSQFQSSVYIDRAFISKSMEGYGRANPDDYNMKLRLRENFLFEILGKKNMKIGAMEERLKHQKVLIIIDDLDDQDVLDALVGRTQWFGSGSRIIVVTKNKHFLRAHGIDHVYEACLPSEELALEMFCRYAFRKNSPPDGFMELSSEVALRAGNLPLGLKVLGSYLRGRDIEDWMDMMPRLQNDLDGKIEKTLRVSYD

Gene3D: G3DSA:3.40.50.300
182-214 G3DSA:3.40.50.300

DFEEFVGIKDHIEKVRLLLHLESDEVRMVGIWG

HMMPfam: PF00931
IPR002182
190-452 NB-ARC,NBS
NB-ARC

KDHIEKVRLLLHLESDEVRMVGIWGTSGIGKTTIARALFSNLSSQFQSSVYIDRAFISKSMEGYGRANPDDYNMKLRLRENFLFEILGKKNMKIGAMEERLKHQKVLIIIDDLDDQDVLDALVGRTQWFGSGSRIIVVTKNKHFLRAHGIDHVYEACLPSEELALEMFCRYAFRKNSPPDGFMELSSEVALRAGNLPLGLKVLGSYLRGRDIEDWMDMMPRLQNDLDGKIEKTLRVSYDGLNNKKDEAIFRHIACLFNGEKVN

HMMSmart: SM00382
IPR003593
206-349 AAA,NBS
AAA+ ATPase domain

EVRMVGIWGTSGIGKTTIARALFSNLSSQFQSSVYIDRAFISKSMEGYGRANPDDYNMKLRLRENFLFEILGKKNMKIGAMEERLKHQKVLIIIDDLDDQDVLDALVGRTQWFGSGSRIIVVTKNKHFLRAHGIDHVYEACLPS

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

MVGIWGTSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
215-364 G3DSA:3.40.50.300

TSGIGKTTIARALFSNLSSQFQSSVYIDRAFISKSMEGYGRANPDDYNMKLRLRENFLFEILGKKNMKIGAMEERLKHQKVLIIIDDLDDQDVLDALVGRTQWFGSGSRIIVVTKNKHFLRAHGIDHVYEACLPSEELALEMFCRYAFRK

FPrintScan: PR00364
IPR000767
289-303 DISEASERSIST
Disease resistance protein

RLKHQKVLIIIDDLD

FPrintScan: PR00364
IPR000767
382-396 DISEASERSIST
Disease resistance protein

AGNLPLGLKVLGSYL

Gene3D: G3DSA:3.40.50.300
410-445 G3DSA:3.40.50.300

RLQNDLDGKIEKTLRVSYDGLNNKKDEAIFRHIACL

superfamily: SSF46785
417-523 SSF46785

GKIEKTLRVSYDGLNNKKDEAIFRHIACLFNGEKVNDIKLLLAESDLDVNIGLKNLVDKSLIFVREDTIEMHRLLQDMGKEIVRAQSNEPGEREFLVDSKHIYDVLE

superfamily: SSF52058
486-941 SSF52058,LRR

EMHRLLQDMGKEIVRAQSNEPGEREFLVDSKHIYDVLEDNTGTKKVLGIALDINETDGLYIHESAFKGMRNLLFLNFYTKQKKDVTWHLSEGFDHLPPKLRLLSWEKYPLRCMPSNFRPENLVKLQMCESKLEKLWDGVHSLTGLRNMDLRGSENLKEIPDLSLATNLKKLDVSNCTSLVELSSTIQNLNQLEELQMERCENLENLPIGINLESLYCLNLNGCSKLRSFPDISTTISELYLSETAIEEFPTELHLENLYYLGLYDMKSEKLWKRVQPLTPLMTMLSPSLTKLFLSDIPSLVELPSSFQNLHNLEHLNIARCTNLETLPTGVNLELLEQLDFSGCSRLRSFPDISTNIFSLVLDGTGIEEVPWWIEDFYRLSFLSMIGCNNLQGVSLNISKLEKLETVDFSDCEALSHANWDTIPSAVAMATENIHSKLPVCIKFSNCFNLDHKAVL

Gene3D: G3DSA:3.80.10.10
536-762 G3DSA:3.80.10.10

LDINETDGLYIHESAFKGMRNLLFLNFYTKQKKDVTWHLSEGFDHLPPKLRLLSWEKYPLRCMPSNFRPENLVKLQMCESKLEKLWDGVHSLTGLRNMDLRGSENLKEIPDLSLATNLKKLDVSNCTSLVELSSTIQNLNQLEELQMERCENLENLPIGINLESLYCLNLNGCSKLRSFPDISTTISELYLSETAIEEFPTELHLENLYYLGLYDMKSEKLWKRVQP

HMMPfam: PF07725
IPR011713
606-624 LRR_3
Leucine-rich repeat 3

NLVKLQMCESKLEKLWDGV

HMMPfam: PF00560
IPR001611
652-674 LRR_1
Leucine-rich repeat

NLKKLDVSNCTSLVELSSTIQNL

Gene3D: G3DSA:3.80.10.10
769-903 G3DSA:3.80.10.10

MLSPSLTKLFLSDIPSLVELPSSFQNLHNLEHLNIARCTNLETLPTGVNLELLEQLDFSGCSRLRSFPDISTNIFSLVLDGTGIEEVPWWIEDFYRLSFLSMIGCNNLQGVSLNISKLEKLETVDFSDCEALSHA

HMMPfam: PF13855
772-829 LRR_8,Leucine rich repeat

PSLTKLFLSDIPSLVELPSSFQNLHNLEHLNIARCTNLETLPTGVNLELLEQLDFSGC

FPrintScan: PR00364
IPR000767
816-832 DISEASERSIST
Disease resistance protein

VNLELLEQLDFSGCSRL

Gene3D: G3DSA:3.40.50.300
1019-1075 G3DSA:3.40.50.300

NYLDSPYQHEVFAVLEKGSHMVISDCCFPFNEDNAPLAELIYDHVDIQFHFTQENDE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox