PRGDB00047068 (disease resistance protein (NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18416947 (NM_118856)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (NBS-LRR class), putative (AT4G27220) mRNA, complete cds.

DNA Sequence

ATGTTCAGATCGAACGCAAGAGCGTTGAATAGAGCATTGGAGAGACTAAAGAATGTGCAGACCAAGGTGAATGAAGCTCTTAAGAGATCAGGGATCCAAGAGAAATCTTTGGAGCGAAAGCTGAGGATATGGCTAAGAAAGGTCGAAGAGAATGTGCCTCTTGGTGAGCTGATTTTGGAGAAACGCTCTTCATGTGCTATATGGCTGAGCGACAAAGATGTGGAAATTCTTGAGAAAGTCAAAAGGCTGGAGGAGCAAGGCCAAGATCTCATAAAAAAGATTTCAGTCAACAAGTCATCTAGAGAAATAGTTGAACGGGTCTTGGGGCCTTCATTTCATCCTCAAAAAACAGCACTGGAGATGTTGGATAAGCTAAAGGATTGTTTGAAGAAGAAGAATGTTCAAAAGATTGGTGTTTGGGGTATGGGCGGTGTTGGGAAGACAACACTTGTCAGGACGCTTAACAATGATCTCTTGAAATATGCTGCTACTCAACAGTTTGCTTTGGTAATTTGGGTGACAGTGTCGAAAGATTTTGACTTAAAAAGGGTCCAGATGGACATAGCCAAGAGACTGGGCAAGCGATTTACAAGGGAGCAAATGAATCAGCTAGGCTTAACTATTTGTGAGAGGCTAATAGATTTGAAAAATTTCCTCCTTATTCTTGACGATGTTTGGCACCCCATTGATTTGGACCAATTGGGTATTCCATTAGCATTGGAACGATCGAAGGATTCAAAGGTTGTTCTAACTTCAAGAAGACTAGAAGTGTGCCAACAGATGATGACTAATGAAAACATCAAAGTTGCATGCTTACAAGAGAAAGAAGCTTGGGAATTGTTTTGCCACAACGTTGGAGAAGTAGCAAACTCTGATAATGTTAAGCCCATTGCAAAGGATGTATCCCATGAATGTTGTGGATTGCCTTTGGCTATCATCACAATCGGGCGGACCCTGCGCGGAAAACCTCAAGTCGAGGTATGGAAACACACCTTGAATTTGCTAAAGAGATCAGCACCTTCTATCGATACTGAAGAAAAGATCTTTGGTACTTTAAAACTCAGCTACGACTTTCTTCAAGACAATATGAAAAGTTGCTTCCTTTTCTGTGCTTTATTTCCGGAGGACTACTCTATCAAAGTAAGTGAACTAATAATGTACTGGGTCGCGGAAGGATTGTTGGATGGACAACATCATTACGAGGACATGATGAATGAGGGAGTTACTTTGGTTGAGAGATTGAAGGACTCTTGCCTGTTAGAAGATGGTGATAGTTGTGATACAGTTAAAATGCACGATGTTGTGCGTGACTTTGCTATATGGTTCATGTCTTCTCAGGGTGAAGGATTTCATTCTCTTGTCATGGCCGGGAGAGGTCTAATAGAGTTTCCACAAGATAAGTTTGTTTCTTCAGTCCAGAGAGTTTCTTTGATGGCTAATAAGCTAGAAAGACTACCTAATAATGTGATAGAGGGTGTGGAAACATTAGTTTTACTACTACAAGGGAATTCCCATGTTAAGGAAGTTCCTAATGGGTTCTTACAAGCATTCCCAAACCTTAGAATCTTGGATCTCAGTGGTGTTCGTATAAGAACATTGCCAGACTCCTTTTCAAATCTTCATAGTTTGCGGTCTCTTGTGTTAAGAAACTGTAAAAAATTGAGGAACCTGCCTTCGCTAGAATCCCTTGTTAAACTCCAATTTCTTGATCTACATGAATCTGCCATTAGGGAACTTCCGAGAGGTCTTGAAGCGTTGAGCAGCTTAAGATACATTTGCGTTTCCAACACATATCAACTCCAGAGCATTCCGGCTGGAACTATTCTCCAGTTATCAAGTTTGGAGGTTCTAGACATGGCGGGGAGTGCTTATAGTTGGGGCATCAAGGGAGAAGAAAGAGAAGGACAAGCAACACTTGACGAGGTTACATGCCTCCCTCATTTGCAGTTTCTTGCCATTAAGCTCCTCGATGTCTTGTCCTTTTCCTATGAATTTGATTCTTTGACCAAAAGGCTAACAAAGTTCCAGTTTCTATTTTCACCTATTCGATCGGTTTCACCTCCTGGCACCGGTGAAGGTTGCCTAGCAATCAGTGATGTCAATGTCTCAAATGCATCTATTGGGTGGCTACTGCAACATGTGACATCACTAGACTTGAACTATTGTGAGGGTCTTAATGGTATGTTCGAGAACTTGGTAACGAAGAGCAAAAGTAGCTTTGTTGCCATGAAAGCACTGTCCATTCACTATTTTCCCAGCTTAAGCCTTGCGAGTGGTTGTGAGTCCCAACTGGATCTCTTTCCAAATCTCGAGGAACTTTCTTTGGACAATGTCAATCTGGAAAGCATCGGAGAACTTAATGGTTTCCTCGGGATGAGACTTCAGAAACTAAAACTACTTCAAGTCTCTGGCTGCCGACAGCTTAAACGTCTTTTCTCAGACCAAATCTTAGCAGGTACTCTGCCAAACCTACAAGAGATAAAGGTTGTCTCATGTTTGAGGTTGGAGGAGCTCTTCAATTTTTCTTCAGTGCCAGTTGATTTTTGTGCTGAGTCTTTGCTACCTAAGCTAACTGTCATAAAACTCAAATATCTTCCACAATTAAGGAGCTTATGCAACGACAGAGTGGTGCTCGAATCCCTGGAACACTTAGAAGTCGAATCTTGTGAAAGTTTAAAGAACTTACCCTTTGTCCCCGGCAATACTGGTATGATCAACGAACAAATGGCGTGGGAATACATGTCTAGGACTCTAGGGTAA


Protein sequences

Name Description Sequence
disease resistance protein (NBS-LRR class), putative disease resistance protein (NBS-LRR class), putative [Arabidopsis thaliana].

MFRSNARALNRALERLKNVQTKVNEALKRSGIQEKSLERKLRIWLRKVEENVPLGELILEKRSSCAIWLSDKDVEILEKVKRLEEQGQDLIKKISVNKSSREIVERVLGPSFHPQKTALEMLDKLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNNDLLKYAATQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVCQQMMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKIFGTLKLSYDFLQDNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLSLASGCESQLDLFPNLEELSLDNVNLESIGELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSLCNDRVVLESLEHLEVESCESLKNLPFVPGNTGMINEQMAWEYMSRTLG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
4-901 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SNARALNRALERLKNVQTKVNEALKRSGIQEKSLERKLRIWLRKVEENVPLGELILEKRSSCAIWLSDKDVEILEKVKRLEEQGQDLIKKISVNKSSREIVERVLGPSFHPQKTALEMLDKLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNNDLLKYAATQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVCQQMMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKIFGTLKLSYDFLQDNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLSLASGCESQLDLFPNLEELSLDNVNLESIGELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSLCNDRVVLESLEHLEVESCESLKNLPFVPGN

HMMPfam: PF00931
IPR002182
121-395 NB-ARC,NBS
NB-ARC

MLDKLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNNDLLKYAATQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVCQQMMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKIFGTLKLSYDFLQDNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLD

superfamily: SSF52540
122-341 SSF52540

LDKLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNNDLLKYAATQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVCQQMMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPS

Gene3D: G3DSA:3.40.50.300
124-259 G3DSA:3.40.50.300

KLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNNDLLKYAATQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVCQ

FPrintScan: PR00364
IPR000767
136-151 DISEASERSIST
Disease resistance protein

KIGVWGMGGVGKTTLV

FPrintScan: PR00364
IPR000767
212-226 DISEASERSIST
Disease resistance protein

LIDLKNFLLILDDVW

FPrintScan: PR00364
IPR000767
305-319 DISEASERSIST
Disease resistance protein

CCGLPLAIITIGRTL

superfamily: SSF52058
430-890 SSF52058,LRR

KMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLSLASGCESQLDLFPNLEELSLDNVNLESIGELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSLCNDRVVLESLEHLEVESCE

Gene3D: G3DSA:3.80.10.10
468-716 G3DSA:3.80.10.10

FVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTS

HMMPfam: PF13855
498-552 LRR_8,Leucine rich repeat

LLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCK

Gene3D: G3DSA:3.80.10.10
717-896 G3DSA:3.80.10.10

LDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLSLASGCESQLDLFPNLEELSLDNVNLESIGELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSLCNDRVVLESLEHLEVESCESLKNLP

FPrintScan: PR00364
IPR000767
792-808 DISEASERSIST
Disease resistance protein

MRLQKLKLLQVSGCRQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox