PRGDB00047069 (disease resistance protein (NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18416940 (NM_118853)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (NBS-LRR class), putative (AT4G27190) mRNA, complete cds.

DNA Sequence

ATGGAGTGTTGCGCCCCTGTCATTGGTGAGATTTTGCGTTTGATGTATGAGTCAACGTTCTCAAGAGTCGCTAATGCCATAAAGTTCAAATCAAACGTCAAAGCTCTTAATGAATCACTCGAGAGATTGACAGAGCTTAAGGGTAACATGAGTGAAGATCATGAAACTTTGCTGACCAAAGATAAACCCTTGAGACTCAAGCTAATGCGTTGGCAAAGAGAGGCGGAAGAAGTTATATCTAAAGCAAGGTTAAAACTTGAGGAACGAGTTTCATGCGGTATGTCCTTGAGACCCAGGATGAGTAGGAAACTTGTCAAGATTCTCGATGAAGTGAAAATGCTTGAGAAGGATGGAATAGAGTTTGTCGACATGCTTTCCGTGGAGTCTACACCGGAAAGAGTTGAACATGTTCCAGGGGTCTCAGTTGTTCATCAAACGATGGCGTCAAATATGTTGGCCAAAATTAGAGATGGCTTGACAAGCGAGAAAGCCCAAAAGATTGGTGTTTGGGGCATGGGAGGAGTAGGTAAAACGACATTGGTCAGGACGCTGAACAATAAGCTTCGGGAAGAGGGTGCTACTCAACCATTTGGCTTGGTGATCTTTGTAATAGTTTCCAAAGAGTTTGATCCAAGAGAAGTCCAAAAGCAGATTGCGGAGAGACTGGATATTGATACCCAAATGGAAGAAAGTGAAGAGAAGTTGGCAAGAAGGATTTATGTTGGACTGATGAAAGAGAGAAAGTTTCTTCTCATTCTTGATGACGTTTGGAAACCCATTGATTTGGATCTTTTAGGCATCCCACGAACTGAAGAGAACAAAGGTTCAAAAGTCATTCTGACTTCGAGGTTTTTAGAGGTCTGTCGCAGCATGAAGACAGATCTTGATGTTAGAGTGGATTGCTTACTTGAAGAAGACGCTTGGGAATTGTTTTGCAAAAATGCAGGGGATGTTGTGAGGTCAGACCATGTTAGGAAGATTGCAAAAGCTGTTTCACAAGAATGTGGTGGATTGCCTCTTGCTATCATCACAGTCGGAACAGCTATGCGGGGAAAGAAAAATGTCAAGCTATGGAATCATGTCTTGAGTAAGCTAAGTAAATCAGTACCTTGGATCAAGAGCATTGAAGAGAAGATCTTCCAGCCATTGAAATTGAGCTACGATTTCTTGGAAGACAAGGCAAAGTTTTGTTTTCTCCTTTGTGCTTTGTTTCCAGAAGACTACTCGATTGAAGTTACAGAGGTTGTAAGATATTGGATGGCTGAAGGATTCATGGAGGAACTCGGTTCCCAAGAGGACTCCATGAACGAGGGAATCACAACTGTGGAGAGTTTAAAGGATTATTGTTTGTTAGAAGATGGTGATCGTAGAGACACGGTGAAGATGCATGATGTTGTCCGCGATTTCGCCATATGGATCATGTCTTCCTCACAAGATGATTCCCATTCCCTTGTCATGTCTGGAACGGGTTTGCAAGATATTAGACAAGATAAGCTTGCTCCTTCTCTTCGAAGGGTTTCTTTGATGAACAATAAACTAGAAAGCCTTCCTGATCTTGTAGAAGAGTTCTGCGTAAAAACCTCAGTCTTACTGCTACAAGGCAATTTTCTTCTAAAGGAAGTACCCATTGGATTCTTGCAAGCATTTCCAACTCTTCGAATCTTGAATCTAAGTGGGACTCGCATTAAGTCATTTCCCAGTTGCTCTCTTTTGCGCCTTTTCAGTCTCCATTCTCTCTTCTTAAGAGATTGTTTTAAACTTGTGAAACTACCTTCACTAGAAACCCTTGCCAAACTTGAGCTACTTGATCTCTGTGGCACACATATCCTCGAATTTCCAAGAGGGTTGGAAGAATTAAAGAGATTCAGACACCTTGATCTTTCACGAACACTTCACCTTGAAAGCATTCCAGCTAGAGTTGTTTCGAGGTTATCAAGTTTGGAGACACTTGACATGACGTCAAGTCACTACCGCTGGAGCGTACAGGGAGAAACACAAAAAGGGCAAGCAACAGTTGAAGAGATAGGATGCCTCCAGCGTTTACAGGTTCTTTCCATCAGGCTCCATTCTTCTCCATTTCTTTTAAATAAGAGAAACACTTGGATCAAAAGATTGAAGAAATTCCAACTTGTAGTTGGGTCTCGTTACATTTTGCGTACAAGGCACGACAAGAGGAGGCTAACAATAAGTCACCTCAACGTATCACAAGTATCCATCGGGTGGCTGTTGGCTTATACAACATCTCTAGCACTAAACCATTGTCAGGGGATCGAAGCAATGATGAAGAAATTGGTAAGTGACAACAAGGGTTTCAAGAATTTGAAATCTCTGACGATTGAGAACGTTATCATCAATACGAATTCTTGGGTTGAGATGGTAAGCACTAACACTTCAAAACAATCCTCTGACATACTAGACCTTCTTCCAAATTTGGAGGAACTTCATCTGCGTCGTGTTGACTTGGAAACCTTCTCAGAGCTACAAACACATCTCGGGTTGAAACTGGAAACACTGAAGATAATCGAGATCACCATGTGTCGCAAGCTTCGAACACTACTCGACAAAAGAAATTTCTTGACTATCCCAAACCTGGAGGAGATAGAGATTAGCTACTGCGACTCTTTGCAGAATCTACACGAGGCTTTGTTATACCATCAACCTTTCGTACCAAATCTACGTGTCTTGAAACTGAGAAATCTTCCAAATCTTGTGAGTATATGCAACTGGGGAGAGGTTTGGGAATGCTTGGAACAAGTGGAAGTGATTCACTGTAATCAGCTGAATTGTTTACCCATAAGCTCTACCTGTGGAAGAATCAAGAAGATAAAAGGAGAATTGAGTTGGTGGGAGCGTTTGGAATGGGACGATCCCTCTGCTTTAACCACTGTTCAACCATTTTTCAATCCAGTGAGGGAAGTTCCTCTACTCATAGCGGATGCAACAACTCAAATGCTATAA


Protein sequences

Name Description Sequence
disease resistance protein (NBS-LRR class), putative disease resistance protein (NBS-LRR class), putative [Arabidopsis thaliana].

MECCAPVIGEILRLMYESTFSRVANAIKFKSNVKALNESLERLTELKGNMSEDHETLLTKDKPLRLKLMRWQREAEEVISKARLKLEERVSCGMSLRPRMSRKLVKILDEVKMLEKDGIEFVDMLSVESTPERVEHVPGVSVVHQTMASNMLAKIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSKSVPWIKSIEEKIFQPLKLSYDFLEDKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHDKRRLTISHLNVSQVSIGWLLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPNLRVLKLRNLPNLVSICNWGEVWECLEQVEVIHCNQLNCLPISSTCGRIKKIKGELSWWERLEWDDPSALTTVQPFFNPVREVPLLIADATTQML

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
13-985 PTHR23155:SF108,SUBFAMILY NOT NAMED

RLMYESTFSRVANAIKFKSNVKALNESLERLTELKGNMSEDHETLLTKDKPLRLKLMRWQREAEEVISKARLKLEERVSCGMSLRPRMSRKLVKILDEVKMLEKDGIEFVDMLSVESTPERVEHVPGVSVVHQTMASNMLAKIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSKSVPWIKSIEEKIFQPLKLSYDFLEDKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHDKRRLTISHLNVSQVSIGWLLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPNLRVLKLRNLPNLVSICNWGEVWECLEQVEVIHCNQLNCLPISSTCGRIKKIKGELSWWERLEWDDPSALTTVQPFFNPVREVPLLIADATTQML

HMMPanther: PTHR23155
13-985 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RLMYESTFSRVANAIKFKSNVKALNESLERLTELKGNMSEDHETLLTKDKPLRLKLMRWQREAEEVISKARLKLEERVSCGMSLRPRMSRKLVKILDEVKMLEKDGIEFVDMLSVESTPERVEHVPGVSVVHQTMASNMLAKIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSKSVPWIKSIEEKIFQPLKLSYDFLEDKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHDKRRLTISHLNVSQVSIGWLLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPNLRVLKLRNLPNLVSICNWGEVWECLEQVEVIHCNQLNCLPISSTCGRIKKIKGELSWWERLEWDDPSALTTVQPFFNPVREVPLLIADATTQML

superfamily: SSF52540
124-371 SSF52540

MLSVESTPERVEHVPGVSVVHQTMASNMLAKIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSKSVPW

HMMPfam: PF00931
IPR002182
150-426 NB-ARC,NBS
NB-ARC

NMLAKIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSKSVPWIKSIEEKIFQPLKLSYDFLEDKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFME

Gene3D: G3DSA:3.40.50.300
161-266 G3DSA:3.40.50.300

SEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLG

HMMSmart: SM00382
IPR003593
163-305 AAA,NBS
AAA+ ATPase domain

KAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEE

FPrintScan: PR00364
IPR000767
166-181 DISEASERSIST
Disease resistance protein

KIGVWGMGGVGKTTLV

FPrintScan: PR00364
IPR000767
243-257 DISEASERSIST
Disease resistance protein

LMKERKFLLILDDVW

FPrintScan: PR00364
IPR000767
335-349 DISEASERSIST
Disease resistance protein

CGGLPLAIITVGTAM

superfamily: SSF52058
445-920 SSF52058,LRR

LKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHDKRRLTISHLNVSQVSIGWLLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPNLRVLKLRNLPNLVSICNWGEVWECLEQVE

Gene3D: G3DSA:3.80.10.10
501-658 G3DSA:3.80.10.10

PSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYR

ProfileScan: PS51450
IPR001611
502-523 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRRVSLMNNKLESLPDLVEEF

ProfileScan: PS51450
IPR001611
551-572 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLRILNLSGTRIKSFPSCSLLR

HMMPfam: PF00560
IPR001611
552-569 LRR_1
Leucine-rich repeat

LRILNLSGTRIKSFPSCS

ProfileScan: PS51450
IPR001611
575-597 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLHSLFLRDCFKLVKLPSLETLA

FPrintScan: PR00364
IPR000767
594-610 DISEASERSIST
Disease resistance protein

ETLAKLELLDLCGTHIL

ProfileScan: PS51450
IPR001611
598-620 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLELLDLCGTHILEFPRGLEELK

Gene3D: G3DSA:3.80.10.10
747-931 G3DSA:3.80.10.10

TSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPNLRVLKLRNLPNLVSICNWGEVWECLEQVEVIHCNQLNCLP

ProfileScan: PS51450
IPR001611
810-831 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEELHLRRVDLETFSELQTHL

ProfileScan: PS51450
IPR001611
848-868 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRTLLDKRNFLTIPNLEEIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox