PRGDB00047070 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18414202 (NM_117515)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT4G14370) mRNA, complete cds.

DNA Sequence

ATGTTCGATGATCAGGAGATCGAGAGAAGTCAAACCATCGCACCTGCTCTCATTAAAGCCATTAAGGAATCAAGAATCTCAATCATCTTGCTATCGAAGAACTATGCTTCTTCGAGCTGGTGTTTGGATGAGTTGTTGGAGATTGTCAAGTGCAAGGAAGCTATGGGACAAATAGTGATGACGGTCTTCTACGGAGTAGATCCATCTGATGTGCGGAAACAAACAGGAGAATTCGGGAGGTCTTTCAATGAAACGTGTTCTCGAAGTACGAAAGAGAAGAGGCGAAAATGGAGTCAAGCTTTGAACCATGTGGGAAACATAGCTGGAGAACACTTCCAAAACTGGGACAATGAATCAAAGATGATTGAAAAGATTTCAAGAGATATTTCAAACAAACTAAATTCTACAATCTCTAGAGATTTTGACGATATGGTTGGACTTGAAGCACACTTGGAGGAAATGAAGTACTTGTTAGATTTAGATTATAAGGATGGAGCTATGATAGTTGGAATTTGTGGTCCTGCAGGCATTGGTAAGACTACTATTGCTAGAGCTTTATATAGTTTACTTTTAAGTAGTTTCCAGCTTAGTTGTTTTGTGGAGAATCTTAGTGGAAGCGATAATAGAGGTCTTGACGAGTATGGTTTTAAGCTGCGTTTACAAGAGCAACTTCTTTCAAAGATTTTAAACCAAAATGGTATGAGGATATACCATTTAGGTGCAATACAAGAAAGGCTATGCGACCAAAAAGTGCTTATCGTTCTTGATGATGTGAATGATCTAAAGCAATTAGAGGCTTTGGCTAATGAGACTAGTTGGTTTGGTCCTGGAAGTAGGATCATTGTGACCACAGAAGATAAAGGGCTTTTGGAGCAACATGGTATCAACAAAACTTACCATGTAGGTTTTCCATCTATAGAAGAAGCTCTTGAGATCTTTTGTATATATGCTTTTAGAAAAAGCTCTCCACCTGATGGTTTCAAAAAGCTTACAAAGAGAGTAACAAATGTTTTTGATAACCTTCCATTGGGTCTTCGTGTCATGGGTTCATCTTTACGCGGGAAGGGGGAAGATGAGTGGGAAGCTCTATTGGACAGGCTAGAAACTAGTCTAGATCGAAATATCGAGGGAGCGCTAAGAGTTGGGTATGATAGCTTGCAGGAAGAAGAACAAGCTCTATTTCTCCACATTGCGGTCTTTTTCAACTACAACAAAGATGAGCATGTGATTGCTATGCTCGCAGACAGTAACTTGGATGTCAAGCAAGGGTTAAAAATCCTAACCAATAAATCACTCGTATATAGATCTACCAGTGGGAAAATAGTAATGCACAAATTACTACAACAAGTGGGTAGAAAAGCAATTCAAAGACAAGAGCCTTGGAAACGTCACATCTTAATAGATGCGCATGAGATTTGTTATGTTCTTGAGAATGATACAGATACTAGAGCTGCTTTAGGCATATCGCTTGATACATCTGGAATCAACAAAGTTATCATAAGTGAGGGAGCTTTCAAAAGAATGCGTAATCTTCGATTCCTAAGTGTCTACAATACAAGATATGTTAAAAATGATCAAGTGGACATACCTGAGGACTTGGAGTTTCCACCTCATCTACGGTTGCTTCGGTGGGAAGCATACCCGAAACTTGATATGAAGGAGAGCCAGCTTGAGAAGCTTTGGCAAGGAACACAGCCACTTACAAATCTCAAGAAAATGGATTTGACACGATCCTCTCATTTGAAGGAACTTCCAGATCTTTCAAATGCTACAAATCTCGAGAGGTTGGAGCTGAGTTATTGCAAGAGTTTGGTAGAGATTCCTTCCTCATTTTCGGAACTTCGAAAACTAGAGACGTTGGTAATACACAACTGCACAAAGCTAGAAGTTGTTCCAACTCTCATCAACTTGGCATCTCTTGATTTCTTCAACATGCATGGTTGCTTCCAACTGAAAAAATTTCCAGGTATTTCTACACACATCTCAAGACTCGTTATAGATGACACACTGGTAGAAGAACTTCCTACATCAATAATACTTTGCACTCGGCTTAGAACTCTCATGATAAGCGGCAGTGGAAACTTTAAGACATTAACATATCTCCCTCTGAGTCTAACGTATCTAGACCTAAGGTGTACGGGGGGCTGTAGAAACCTAAAATCGCTGCCACAGCTTCCTCTTTCGATCAGGTGGTTAAATGCATGTGACTGCGAATCACTCGAGAGTGTTGCTTGCGTTTCAAGCTTAAATTCATTTGTGGACCTAAATTTCACCAATTGCTTCAAACTGAACCAAGAAACACGAAGAGATCTTATCCAACAATCATTCTTTCGCAGTTTGAGAATTTTACCAGGAAGAGAAGTGCCCGAAACGTTCAATCACCAAGCTAAAGGAAATGTCTTGACTATTCGTCCGGAGAGTGATAGTCAATTTTCTGCATCCTCAAGATTTAAAGCTTGCTTTGTGATTTCCCCTACCAGGTTAATCACGGGGAGAAAAAGGCTTATTAGTTTATTGTGTCGTCTCATAAGCAAAAACGGTGACTCCATCAACGAAGTTTATCATTGTTTCAGCTTACCTGATCAGTCCCCGGGAACACAATCGGAACATCTTTGTTTATTTCACTATGACTTCCACGACAGAGATAGATATTTTGAAGTAGATAGTGAGATATTGTTCGAATTTAGCTGCACACCTTCTGACGCCTACGAGATCGTTCAGTGCGGTGTTGGAACTTATGGAGAAGAAATCGAACAAATCAGCGATTGGAGCAATGCATCTGAAGAAATAGAAACTGAAAATATTTCTGACGACGTCAACCAATATAGAGATAGACATCCTTGCAAATCAGATAAGGCATCAAAAGAAGCCAATCATTTATATCTCATATATATGCCTCTTAACAACTTCTCAAAGGAGAAGGAATTGAAGACGGATGCATCTATGAAGACAGATGGAATGGCAGATCCCTCTAGCTATGTCAATCATGACCGTGACATCGACCAAGCACTCGTTTCTTTGAAAAAAGGAACTCAATTACTTAAGTATAGCCGCAAAGGAAGGCCTAAATTTCGCTCATTCAGGCTTTCGCCGGCTGTTTTTCGAAGATATTTACGTCCCGAAAAGGATTACTTGTCATTTTCTCTCATATATCACAACGGAGATAGATCTCTTGATCTGATTTGCAAAGACAAAGCTGAAACAGAGGTTTGGTTTGCAGGACTTAAGTCTTTAATTAGACAAAACCGTAACAAGCAAGCCAAAAGTGAGATCCCTGAGATACATGACAGTGATTGTTTCTCTACTGGTCGTCCTTCTACTGCATCTATAGATTTCGCACCAAACAATACTCGACGTGGAAGAACATCCATTGATTTAGGAATCCAGAACTCTCCAACAAAGTTTGGTAGCTCAGATGTGGGATATGAACGTGGAAACATGCTAAGACCAAGTACTGATGGTTTTCGAATTAGTGTCTCAAGCACACCAAGTTGTTCAACTGGAACTTCTGGTCCTGATGACATAGAATCCTTAGGAGATGTTTATGTCTGGGGAGAAGTTTGGAGCGACGGGATATCACCAGACGGGGTCGTAAACTCCACAACTGTAAAAATAGATATAGCTTGCGGTGTAAGGCATATCGCTCTTGTGACAAGACAAGGTGAAGTCTTTACATGGGAAGAAGAAGCTGGAGGAAGGCTTGGACATGGTATTCAAGTCGACGTTTGTCGTCCAAAACTTGTTGAGTTTCTTGCTCTTACCAATATAGATTTTGTTGCTTGTGGAGAATATCATACTTGTGCTGTATCTACGTCCGGAGATTTGTTTACTTGGGGAGATGGAATCCATAATGTTGGACTTTTGGGACATGGAAGTGATCTTAGTCATTGGATACCGAAAAGAGTCTCTGGTCCTGTGGAAGGACTTCAAGTCTTGTCTGTTGCGTGTGGCACGTGGCATTCCGCGCTTGCGACTGCTAATGGAAAACTATTCACTTTTGGTGATGGAGCGTTTGGTGTTCTTGGACATGGAGATAGAGAGAGTGTTTCATACCCTAAAGAAGTGAAAATGTTGAGTGGTCTTAAAACCTTGAAAGTAGCTTGTGGCGTGTGGCATACGGTAGCTATAGTTGAAGTTATGAATCAGACCGGTACTAGTACCTCATCTAGAAAGTTGTTTACTTGGGGCGATGGTGATAAAAACAGGCTAGGACATGGAAATAAAGAGACTTATCTTCTTCCAACTTGTGTATCTTCACTAATTGACTACAACTTTAACCAAATCGCGTGTGGTCATACATTCACAGTTGCGCTCACAACCTCAGGACATGTTTTTACTATGGGAGGGACTTCACATGGTCAGCTTGGTAGCTCGAATTCTGATGGTAAACTGCCTTGCTTGGTTCAAGATCGATTGGTTGGTGAATTCGTTGAAGAAATATCATGTGGGGATCATCATGTTGCTGTCCTGACATCGAGAAGTGAAGTCTTTACTTGGGGAAAAGGTTCAAATGGAAGACTAGGACATGGGGACAAGGATGATCGAAAAACGCCAACATTAGTTGAAGCTCTAAGGGAGAGGCATGTGAAGAGTATATCATGTGGAGCTGATCAATCTGTTTGTTCTGGTTGTCGTCAAGCATTTGGTTTTACGAGAAAGAGGCATAATTGTTATAACTGCGGTTTAGTGCATTGCCATGCGTGTAGTTCCAAGAAAGCTTTGAAAGCAGCATTAGCTCCAACTCCAGGGAAACCACATCGAGTATGTGATGCTTGTTACACAAAACTTAAAGCTGGAGAGTCTGGTTATAACTCTAATGTTGCTAATAGAAATTCCACAACTCCTACACGGTCACTAGATGGGACAGGAAGACCAGACAGAGATATAAGGTCTTCAAGGATTCTACTGTCCCCCAAAACAGAACCAGTCAAGTATTCTGAGGTTAGGTCATCAAGATCTGAATCTTCTATTGTCAGAGCTTCACAAGTTCCAGCTCTCCAGCAACTTAGAGATGTTGCATTCCCAAGCTCTCTTAGCGCGATTCAAAATGCCTTTAAACCCGTTGCCTCATCTTCGACATCGACACTTCCTTCGGGTACAAGATCATCAAGAATATCAAGCCCTCCACGCAGTTCTGGATTTTCCAGGGGCATGATTGATACTTTGAAGAAATCTAACGGTGTTATAAACAAAGAAATGACAAAATTGCAAAGCCAGATTAAAAATTTGAAAGAGAAATGTGATAATCAAGGTACAGAGATCCAAAGACTAAAGAAAACAGCAAGAGAAGCTTCTGACTTAGCTGTAAAACATTCTTCAAAGCATAAGGCAGCAACAGAGGTCATGAAATCTGTCGCTGAACATTTGAGAGAGTTAAAAGAGAAACTACCTCCTGAAGTATCAAGATGTGAAGCTTTTGAATCCATGAATTCTCAAGCAGAAGCCTATCTAAATGCGAGCGAAGCATCTGAATCATGTTTACCTACAACATCCTTGGGAATGGGTCAACGAGATCCAACCCCTTCTACAAACACACAAGATCAAAACATAGAGGAAAAACAATCATCTAATGGAGGTAACATGAGATCTCAAGAACCTTCAGGGACAACAGAAGCTTCATCATCGTCTAAAGGAGGAGGGAAAGAACTTATCGAACAATTTGAACCGGGTGTTTATGTTACTTATGTATTGCACAAGAATGGCGGAAAGATATTTAGAAGAGTTAGATTCAGTTTCTTTGTAGCAAACGGAGATTTGATGAGCATCAAGCAGAAGAATGGTGGAATAGCAAAAAAGATAGGTTGCTTAAGAGTTCCAACACCAACTCAACCTCAACCACCAGCTTCTGATTCAGTTCCTACACCAACTCAACCTCAACCACCAGCTTCTGATTCAGTTCCTACACCAACTCAACCTCAACCACCAGCTTCTCCTACACAACCGAATTCTGATCAAGCAGAGGATTCAAAAGAAGTTCTTGATGAAAGCTAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MFDDQEIERSQTIAPALIKAIKESRISIILLSKNYASSSWCLDELLEIVKCKEAMGQIVMTVFYGVDPSDVRKQTGEFGRSFNETCSRSTKEKRRKWSQALNHVGNIAGEHFQNWDNESKMIEKISRDISNKLNSTISRDFDDMVGLEAHLEEMKYLLDLDYKDGAMIVGICGPAGIGKTTIARALYSLLLSSFQLSCFVENLSGSDNRGLDEYGFKLRLQEQLLSKILNQNGMRIYHLGAIQERLCDQKVLIVLDDVNDLKQLEALANETSWFGPGSRIIVTTEDKGLLEQHGINKTYHVGFPSIEEALEIFCIYAFRKSSPPDGFKKLTKRVTNVFDNLPLGLRVMGSSLRGKGEDEWEALLDRLETSLDRNIEGALRVGYDSLQEEEQALFLHIAVFFNYNKDEHVIAMLADSNLDVKQGLKILTNKSLVYRSTSGKIVMHKLLQQVGRKAIQRQEPWKRHILIDAHEICYVLENDTDTRAALGISLDTSGINKVIISEGAFKRMRNLRFLSVYNTRYVKNDQVDIPEDLEFPPHLRLLRWEAYPKLDMKESQLEKLWQGTQPLTNLKKMDLTRSSHLKELPDLSNATNLERLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCFQLKKFPGISTHISRLVIDDTLVEELPTSIILCTRLRTLMISGSGNFKTLTYLPLSLTYLDLRCTGGCRNLKSLPQLPLSIRWLNACDCESLESVACVSSLNSFVDLNFTNCFKLNQETRRDLIQQSFFRSLRILPGREVPETFNHQAKGNVLTIRPESDSQFSASSRFKACFVISPTRLITGRKRLISLLCRLISKNGDSINEVYHCFSLPDQSPGTQSEHLCLFHYDFHDRDRYFEVDSEILFEFSCTPSDAYEIVQCGVGTYGEEIEQISDWSNASEEIETENISDDVNQYRDRHPCKSDKASKEANHLYLIYMPLNNFSKEKELKTDASMKTDGMADPSSYVNHDRDIDQALVSLKKGTQLLKYSRKGRPKFRSFRLSPAVFRRYLRPEKDYLSFSLIYHNGDRSLDLICKDKAETEVWFAGLKSLIRQNRNKQAKSEIPEIHDSDCFSTGRPSTASIDFAPNNTRRGRTSIDLGIQNSPTKFGSSDVGYERGNMLRPSTDGFRISVSSTPSCSTGTSGPDDIESLGDVYVWGEVWSDGISPDGVVNSTTVKIDIACGVRHIALVTRQGEVFTWEEEAGGRLGHGIQVDVCRPKLVEFLALTNIDFVACGEYHTCAVSTSGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTLKVACGVWHTVAIVEVMNQTGTSTSSRKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFNQIACGHTFTVALTTSGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVLTSRSEVFTWGKGSNGRLGHGDKDDRKTPTLVEALRERHVKSISCGADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLKAGESGYNSNVANRNSTTPTRSLDGTGRPDRDIRSSRILLSPKTEPVKYSEVRSSRSESSIVRASQVPALQQLRDVAFPSSLSAIQNAFKPVASSSTSTLPSGTRSSRISSPPRSSGFSRGMIDTLKKSNGVINKEMTKLQSQIKNLKEKCDNQGTEIQRLKKTAREASDLAVKHSSKHKAATEVMKSVAEHLRELKEKLPPEVSRCEAFESMNSQAEAYLNASEASESCLPTTSLGMGQRDPTPSTNTQDQNIEEKQSSNGGNMRSQEPSGTTEASSSSKGGGKELIEQFEPGVYVTYVLHKNGGKIFRRVRFSFFVANGDLMSIKQKNGGIAKKIGCLRVPTPTQPQPPASDSVPTPTQPQPPASDSVPTPTQPQPPASPTQPNSDQAEDSKEVLDES

Domains

Domain Start-End Description Sequence

HMMSmart: SM00255
IPR000157
1-107 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MFDDQEIERSQTIAPALIKAIKESRISIILLSKNYASSSWCLDELLEIVKCKEAMGQIVMTVFYGVDPSDVRKQTGEFGRSFNETCSRSTKEKRRKWSQALNHVGNI

ProfileScan: PS50104
IPR000157
1-107 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MFDDQEIERSQTIAPALIKAIKESRISIILLSKNYASSSWCLDELLEIVKCKEAMGQIVMTVFYGVDPSDVRKQTGEFGRSFNETCSRSTKEKRRKWSQALNHVGNI

Gene3D: G3DSA:3.40.50.10140
2-105 G3DSA:3.40.50.10140

FDDQEIERSQTIAPALIKAIKESRISIILLSKNYASSSWCLDELLEIVKCKEAMGQIVMTVFYGVDPSDVRKQTGEFGRSFNETCSRSTKEKRRKWSQALNHVG

HMMPfam: PF01582
IPR000157
2-103 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FDDQEIERSQTIAPALIKAIKESRISIILLSKNYASSSWCLDELLEIVKCKEAMGQIVMTVFYGVDPSDVRKQTGEFGRSFNETCSRSTKEKRRKWSQALNH

superfamily: SSF52540
24-395 SSF52540

SRISIILLSKNYASSSWCLDELLEIVKCKEAMGQIVMTVFYGVDPSDVRKQTGEFGRSFNETCSRSTKEKRRKWSQALNHVGNIAGEHFQNWDNESKMIEKISRDISNKLNSTISRDFDDMVGLEAHLEEMKYLLDLDYKDGAMIVGICGPAGIGKTTIARALYSLLLSSFQLSCFVENLSGSDNRGLDEYGFKLRLQEQLLSKILNQNGMRIYHLGAIQERLCDQKVLIVLDDVNDLKQLEALANETSWFGPGSRIIVTTEDKGLLEQHGINKTYHVGFPSIEEALEIFCIYAFRKSSPPDGFKKLTKRVTNVFDNLPLGLRVMGSSLRGKGEDEWEALLDRLETSLDRNIEGALRVGYDSLQEEEQALFL

Gene3D: G3DSA:3.40.50.300
139-290 G3DSA:3.40.50.300

RDFDDMVGLEAHLEEMKYLLDLDYKDGAMIVGICGPAGIGKTTIARALYSLLLSSFQLSCFVENLSGSDNRGLDEYGFKLRLQEQLLSKILNQNGMRIYHLGAIQERLCDQKVLIVLDDVNDLKQLEALANETSWFGPGSRIIVTTEDKGLL

HMMPfam: PF00931
IPR002182
149-415 NB-ARC,NBS
NB-ARC

AHLEEMKYLLDLDYKDGAMIVGICGPAGIGKTTIARALYSLLLSSFQLSCFVENLSGSDNRGLDEYGFKLRLQEQLLSKILNQNGMRIYHLGAIQERLCDQKVLIVLDDVNDLKQLEALANETSWFGPGSRIIVTTEDKGLLEQHGINKTYHVGFPSIEEALEIFCIYAFRKSSPPDGFKKLTKRVTNVFDNLPLGLRVMGSSLRGKGEDEWEALLDRLETSLDRNIEGALRVGYDSLQEEEQALFLHIAVFFNYNKDEHVIAMLAD

HMMSmart: SM00382
IPR003593
165-424 AAA,NBS
AAA+ ATPase domain

GAMIVGICGPAGIGKTTIARALYSLLLSSFQLSCFVENLSGSDNRGLDEYGFKLRLQEQLLSKILNQNGMRIYHLGAIQERLCDQKVLIVLDDVNDLKQLEALANETSWFGPGSRIIVTTEDKGLLEQHGINKTYHVGFPSIEEALEIFCIYAFRKSSPPDGFKKLTKRVTNVFDNLPLGLRVMGSSLRGKGEDEWEALLDRLETSLDRNIEGALRVGYDSLQEEEQALFLHIAVFFNYNKDEHVIAMLADSNLDVKQGL

FPrintScan: PR00364
IPR000767
168-183 DISEASERSIST
Disease resistance protein

IVGICGPAGIGKTTIA

FPrintScan: PR00364
IPR000767
245-259 DISEASERSIST
Disease resistance protein

RLCDQKVLIVLDDVN

Gene3D: G3DSA:3.40.50.300
317-371 G3DSA:3.40.50.300

AFRKSSPPDGFKKLTKRVTNVFDNLPLGLRVMGSSLRGKGEDEWEALLDRLETSL

FPrintScan: PR00364
IPR000767
338-352 DISEASERSIST
Disease resistance protein

FDNLPLGLRVMGSSL

superfamily: SSF46785
373-477 SSF46785

RNIEGALRVGYDSLQEEEQALFLHIAVFFNYNKDEHVIAMLADSNLDVKQGLKILTNKSLVYRSTSGKIVMHKLLQQVGRKAIQRQEPWKRHILIDAHEICYVLE

superfamily: SSF52058
472-783 SSF52058,LRR

ICYVLENDTDTRAALGISLDTSGINKVIISEGAFKRMRNLRFLSVYNTRYVKNDQVDIPEDLEFPPHLRLLRWEAYPKLDMKESQLEKLWQGTQPLTNLKKMDLTRSSHLKELPDLSNATNLERLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCFQLKKFPGISTHISRLVIDDTLVEELPTSIILCTRLRTLMISGSGNFKTLTYLPLSLTYLDLRCTGGCRNLKSLPQLPLSIRWLNACDCESLESVACVSSLNSFVDLNFTNCFKLNQETRRDLIQQSFFRSLRIL

Gene3D: G3DSA:3.80.10.10
488-764 G3DSA:3.80.10.10

ISLDTSGINKVIISEGAFKRMRNLRFLSVYNTRYVKNDQVDIPEDLEFPPHLRLLRWEAYPKLDMKESQLEKLWQGTQPLTNLKKMDLTRSSHLKELPDLSNATNLERLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCFQLKKFPGISTHISRLVIDDTLVEELPTSIILCTRLRTLMISGSGNFKTLTYLPLSLTYLDLRCTGGCRNLKSLPQLPLSIRWLNACDCESLESVACVSSLNSFVDLNFTNCFKLN

FPrintScan: PR00364
IPR000767
565-581 DISEASERSIST
Disease resistance protein

QPLTNLKKMDLTRSSHL

superfamily: SSF50729
997-1080 SSF50729

DRDIDQALVSLKKGTQLLKYSRKGRPKFRSFRLSPAVFRRYLRPEKDYLSFSLIYHNGDRSLDLICKDKAETEVWFAGLKSLIR

Gene3D: G3DSA:2.30.29.30
IPR011993
997-1031 PH_type
Pleckstrin homology-like domain

DRDIDQALVSLKKGTQLLKYSRKGRPKFRSFRLSP

HMMPanther: PTHR22870
1012-1659 PTHR22870,REGULATOR OF CHROMOSOME CONDENSATION

QLLKYSRKGRPKFRSFRLSPAVFRRYLRPEKDYLSFSLIYHNGDRSLDLICKDKAETEVWFAGLKSLIRQNRNKQAKSEIPEIHDSDCFSTGRPSTASIDFAPNNTRRGRTSIDLGIQNSPTKFGSSDVGYERGNMLRPSTDGFRISVSSTPSCSTGTSGPDDIESLGDVYVWGEVWSDGISPDGVVNSTTVKIDIACGVRHIALVTRQGEVFTWEEEAGGRLGHGIQVDVCRPKLVEFLALTNIDFVACGEYHTCAVSTSGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTLKVACGVWHTVAIVEVMNQTGTSTSSRKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFNQIACGHTFTVALTTSGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVLTSRSEVFTWGKGSNGRLGHGDKDDRKTPTLVEALRERHVKSISCGADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLKAGESGYNSNVANRNSTTPTRSLDGTGRPDRDIRSSRILLSPKTEPVKYSEVRSSRSESSIVR

HMMPanther: PTHR22870:SF25
1012-1659 PTHR22870:SF25,REGULATOR OF CHROMOSOME CONDENSATION-RELATED

QLLKYSRKGRPKFRSFRLSPAVFRRYLRPEKDYLSFSLIYHNGDRSLDLICKDKAETEVWFAGLKSLIRQNRNKQAKSEIPEIHDSDCFSTGRPSTASIDFAPNNTRRGRTSIDLGIQNSPTKFGSSDVGYERGNMLRPSTDGFRISVSSTPSCSTGTSGPDDIESLGDVYVWGEVWSDGISPDGVVNSTTVKIDIACGVRHIALVTRQGEVFTWEEEAGGRLGHGIQVDVCRPKLVEFLALTNIDFVACGEYHTCAVSTSGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTLKVACGVWHTVAIVEVMNQTGTSTSSRKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFNQIACGHTFTVALTTSGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVLTSRSEVFTWGKGSNGRLGHGDKDDRKTPTLVEALRERHVKSISCGADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLKAGESGYNSNVANRNSTTPTRSLDGTGRPDRDIRSSRILLSPKTEPVKYSEVRSSRSESSIVR

Gene3D: G3DSA:2.30.29.30
IPR011993
1032-1086 PH_type
Pleckstrin homology-like domain

AVFRRYLRPEKDYLSFSLIYHNGDRSLDLICKDKAETEVWFAGLKSLIRQNRNKQ

Gene3D: G3DSA:2.130.10.30
IPR009091
1177-1539 Reg_csome_cond/b-lactamase_inh
Regulator of chromosome condensation/beta-lactamas

SLGDVYVWGEVWSDGISPDGVVNSTTVKIDIACGVRHIALVTRQGEVFTWEEEAGGRLGHGIQVDVCRPKLVEFLALTNIDFVACGEYHTCAVSTSGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTLKVACGVWHTVAIVEVMNQTGTSTSSRKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFNQIACGHTFTVALTTSGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVLTSRSEVFTWGKGSNGRLGHGDKDDRKTPTLVEALRERHVKSISCGADQS

superfamily: SSF50985
IPR009091
1179-1549 RCC1/BLIP-II
Regulator of chromosome condensation/beta-lactamas

GDVYVWGEVWSDGISPDGVVNSTTVKIDIACGVRHIALVTRQGEVFTWEEEAGGRLGHGIQVDVCRPKLVEFLALTNIDFVACGEYHTCAVSTSGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTLKVACGVWHTVAIVEVMNQTGTSTSSRKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFNQIACGHTFTVALTTSGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVLTSRSEVFTWGKGSNGRLGHGDKDDRKTPTLVEALRERHVKSISCGADQSVCSGCRQAFG

PatternScan: PS00626
IPR000408
1207-1217 RCC1_2
Regulator of chromosome condensation, RCC1

IACGVRHIALV

ProfileScan: PS50012
IPR000408
1221-1272 RCC1_3
Regulator of chromosome condensation, RCC1

GEVFTWEEEAGGRLGHGIQVDVCRPKLVEFLALTNIDFVACGEYHTCAVSTS

HMMPfam: PF00415
IPR000408
1221-1269 RCC1
Regulator of chromosome condensation, RCC1

GEVFTWEEEAGGRLGHGIQVDVCRPKLVEFLALTNIDFVACGEYHTCAV

HMMPfam: PF00415
IPR000408
1272-1323 RCC1
Regulator of chromosome condensation, RCC1

SGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSAL

ProfileScan: PS50012
IPR000408
1273-1327 RCC1_3
Regulator of chromosome condensation, RCC1

GDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSVACGTWHSALATAN

HMMPfam: PF00415
IPR000408
1327-1376 RCC1
Regulator of chromosome condensation, RCC1

NGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTLKVACGVWHTVAI

ProfileScan: PS50012
IPR000408
1328-1379 RCC1_3
Regulator of chromosome condensation, RCC1

GKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTLKVACGVWHTVAIVEV

PatternScan: PS00626
IPR000408
1366-1376 RCC1_2
Regulator of chromosome condensation, RCC1

VACGVWHTVAI

ProfileScan: PS50012
IPR000408
1390-1441 RCC1_3
Regulator of chromosome condensation, RCC1

RKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFNQIACGHTFTVALTTS

HMMPfam: PF00415
IPR000408
1392-1438 RCC1
Regulator of chromosome condensation, RCC1

LFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFNQIACGHTFTVAL

HMMPfam: PF00415
IPR000408
1441-1490 RCC1
Regulator of chromosome condensation, RCC1

SGHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVL

ProfileScan: PS50012
IPR000408
1442-1493 RCC1_3
Regulator of chromosome condensation, RCC1

GHVFTMGGTSHGQLGSSNSDGKLPCLVQDRLVGEFVEEISCGDHHVAVLTSR

ProfileScan: PS50012
IPR000408
1494-1545 RCC1_3
Regulator of chromosome condensation, RCC1

SEVFTWGKGSNGRLGHGDKDDRKTPTLVEALRERHVKSISCGADQSVCSGCR

HMMPfam: PF00415
IPR000408
1495-1541 RCC1
Regulator of chromosome condensation, RCC1

EVFTWGKGSNGRLGHGDKDDRKTPTLVEALRERHVKSISCGADQSVC

HMMSmart: SM00064
IPR000306
1529-1598 FYVE
Zinc finger, FYVE-type

VKSISCGADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLKA

superfamily: SSF57903
IPR011011
1530-1620 FYVE_PHD_ZnF
Zinc finger, FYVE/PHD-type

KSISCGADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLKAGESGYNSNVANRNSTTPTRSLD

ProfileScan: PS50178
IPR017455
1535-1597 ZF_FYVE
Zinc finger, FYVE-related

GADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLK

HMMPfam: PF01363
IPR000306
1537-1597 FYVE
Zinc finger, FYVE-type

DQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLK

Gene3D: G3DSA:3.30.40.10
IPR013083
1540-1597 Znf_RING/FYVE/PHD
Zinc finger, RING/FYVE/PHD-type

VCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYTKLK

HMMPfam: PF13713
1771-1806 BRX_N,Transcription factor BRX N-terminal domain

HSSKHKAATEVMKSVAEHLRELKEKLPPEVSRCEAF

HMMPfam: PF08381
IPR013591
1880-1911 BRX
Brevis radix-like domain

GKELIEQFEPGVYVTYVLHKNGGKIFRRVRFS

ProfileScan: PS51514
IPR013591
1881-1940 BRX
Brevis radix-like domain

KELIEQFEPGVYVTYVLHKNGGKIFRRVRFSFFVANGDLMSIKQKNGGIAKKIGCLRVPT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox