PRGDB00047072 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30684800 (NM_118073)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT4G19530) mRNA, complete cds.

DNA Sequence

ATGGCTACCTCATCCTCGGTGGTCAGCAGTGTACCTCAGCAGCACCAAGTGTTCCTCAATTTCCGTGGGGACGAACTTCGTAATAATTTCGTCAGCCATCTGGATAAGGCCTTAAGAGGGAAACAGATCAATGTCTTCATAGATGAGGCTGTGGAAAAAGGTGAAAATCTAGATAACCTTTTCAAGGAGATCGAAAAATCTAGAATCGCGCTGGCTATCATTTCCCAAAAGTACACAGAGTCAAAATGGTGCTTGAACGAGCTGGTTAAAATGAAAGAACTCGAGGGCAAACTCGTGACGATTCCCATCTTCTACAATGTGGAACCTGCTACGGTTAGGTATCAGAAGGAAGCGTTTGGTGCTGCGCTCACAAAAACGCAGGAAAATGATAGTGATGGCCAGATGAAGAAATGGAAAGAGGCTTTGACGTATGTTAGTCTCCTGGTGGGCTTCCCGTTTAACAGTAAAAGCAAGGAGAAGGAGACCACGCTCATCGATAAAATCGTCGACGCCGTTTTGCAAAAGCTGAGTAAAATATCGTCGGAAGAAAGCACAAGTGGATCAGTGGATCAAGGTCGGGGAGAAGAAGTAGAAGAAGCAAAGGCTGATAAGATTTCCGGGCTCAACCAGCGCCTAAAGGAACTGGAAGAAAAGGTAGCCATTACGGGTGACAAGAGAGACGAGACTCGTATTGTCGAAGTTGTTGGGATGCCTGGCATTGGTAAATCCACTCTCTTGAAGGCCTTCTATGAGACATGGAAAACCAGGTTCTTGAGCAGCGCCTTACTCCAAAATATAAGCGAACTTGTAAAAGCAATGGGATTGGGACGCTTGACTGGGATGCTCTTGAAGGAGTTGCTCCCAGATGAAAACATAGACGAGGAGACATACGAACCATACAAGGAGAAACTACTTAAAAACACAGTTTTCATTGTTCTAGATGGCATAAGTGACGAGACACATATACAAAAACTTCTTAAGGATCATCGAAAATGGGCTAAGAAAGGAAGCAAGATTGTGATTGCAAGACGCGCAGTGACTCGTGATCTGCTTCATGAGGATTCAATGGTCCGTTATACTTATTTTGTACCGCTGTTGAGCCATCGAGATGGGTTAAATCACTTTTGTCACTATGCGTTCCGTCATTTTGCGGCCCACCAAAACAACAAGGAAGCTTTCATGAAGGAGTCAAAAGAGTTTGTGCGTTACGCGAGAGGCCACCCACTAATTCTCAAGCTATTGGGTGAAGAGCTTCGTGAGAAAAGCCTCTCTTACTGGGAAGAGAAACTAAAATCACTCCCAAAAAGTCTCAGCCAAAATATTCGAGACCGTGTCTTGCAGGTAACTTATGATGAACTGAGTCAAGTGCAAAAGGATGCGTTTCTTGACATAGCTTGTTTCAGATCCCATGATTTGGTTTATGTAAAGAGCTTACTGGATTCATCTGGTCCCGCCTTTTCTAAAGCGACAGTTACAATAGACGCTCTCAAAGACATGTTCATGATTTACATTTCTGATAGTCGAGTGGAGATGCATGATCTTTTGTATACGTTTGCCATGGAACTTGGTCCAGAAGCCAGGGATGACGATGGAAGAGGGAGACACCGGATATGGCATCATCACAACCAAGATAATAAAGGCAGGCTCAATAGGCTGCTAAAAAGACCAGGAGGCAGCACCAGTGTGAGAAGTTTTTTCCTCGATATGTATGTCATGAAGACGGACGTGACCTTAGGCACTGATTACCTCAAGAACATGCGAAATCTCCGGTACCTCAAGTTTTACAGTTCTCATTGTCCTCAGGAATGTACGCCTAAGGAAAACATACACATCCCTGGAGAACTTGAGCTTCCACTTGAAGAGGTCCGATGTTTGCATTGGCTAAATTTCCCCAAAGATGAACTTCCACAAGATTTCATCCCCAAGAATCTCGTAGATCTTAAGCTCCCTTACAGTAAGATTAGACAGATTTGGAGAGAAGAGAAGGATGCACCAAAACTAAGGTGGGTCGATCTCAATCACTCAAGTAAGTTGGAAAACTTGTCAGGGCTATCACAGGCTCTAAATCTTGAAAGATTGAACCTTGAAGGTTGCACAGCACTGAAAACGTTGCTTCTGGGTCCGGAAAATATGGCAAGTCTTGTTTTCCTGAATTTGAAAGGGTGCACGGGTCTTGAGTCTCTTCCCAAGATTAATTTGAGATCTCTGAAGACTCTCATCCTCAGCAACTGTTCAAACTTGGAGGAGTTTTGGGTGATTTCAGAAACTTTATATACGCTATATTTGGATGGCACTGCAATAAAAACACTTCCTCAAGACATGGTAAAGCTAACAAGCCTCGTCAAATTATACATGAAAGACTGCGAGATGCTCGTTAAGCTTCCCGAAGAATTTGACAAGCTGAAAGTTCTGCAAGAACTAGTATGCTCTGGTTGTAAAAGACTCAGTAGTCTCCCAGATGTGATGAAGAACATGCAATGCTTGCAGATTTTACTGCTTGATGGAACAGCAATAACAAAGATTCCTCATATATCCTCACTTGAGCGTCTATGCTTAAGCAGAAACGAGAAGATCAGTTGTCTTTCGAATGATATTCGTCTGCTTTCTCAACTGAAATGGCTGGACTTGAAGTACTGTACGAAACTTGTGTCTATTCCAGAGCTTCCAACAAATCTTCAGTGCTTAGATGCAAACGGATGTGAATCATTAACAACAGTTGCGAATCCACTGGCTACTCATTTGCCAACGGAGCAGATTCATTCCACATTCATTTTCACAAACTGCGACAAATTAGACCGTACTGCAAAGGAGGGTTTTGTTCCAGAGGCTTTGTTCAGCACTTGCTTCCCTGGGTGTGAAGTACCTTCATGGTTTTGTCATGAAGCAGTTGGATCCGTCTTAAAGCTCAACCTGCTCCCACATTGGAACGAAAATAGGTTTGTCGGAATAGCTTTATGTGCTGTTGTGGGATCCTTACCAAATTGCCAAGAACAAACCAACTCTTGTTCAGTGACATGCACGTTTAACATAGCAAGTAAAGATTCCAAGAAAGGGGATCCTTACAAAATCTCCTTTGATCGACTGGTTGGGCGTTGGAACAAACATGGCAACAAACTAGACAAGAAAGGCAACAAACTAAAGAAGACGGAATCAGATCATGTCTTTATCTGCTATACCAGATGCTCAAACAGCATAAAATGTCTTCAAGACCAGCACTCAGGTACATGTACTCCAACCGAAGCTTTCCTTGAATTTGGTGTGACAGATAAGGAATCTCGACTCGAGGTGCTCAAGTGTGGGTTAAGATTGGTATATGCATCTGATGAACCCCAGAAGACAAACTCAGATATGGATCTTTCATTATCATCATCTGATTCAACTCCGACAAGGAACGGCAGTTCCAACACTACTACATCTAGTGGAAGTGTATCTACCAATACCATTAGAGAAGAAGATTCCAATATCTTACATGAAGCACAATCTCAAAATGGGAGAGGACTTTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MATSSSVVSSVPQQHQVFLNFRGDELRNNFVSHLDKALRGKQINVFIDEAVEKGENLDNLFKEIEKSRIALAIISQKYTESKWCLNELVKMKELEGKLVTIPIFYNVEPATVRYQKEAFGAALTKTQENDSDGQMKKWKEALTYVSLLVGFPFNSKSKEKETTLIDKIVDAVLQKLSKISSEESTSGSVDQGRGEEVEEAKADKISGLNQRLKELEEKVAITGDKRDETRIVEVVGMPGIGKSTLLKAFYETWKTRFLSSALLQNISELVKAMGLGRLTGMLLKELLPDENIDEETYEPYKEKLLKNTVFIVLDGISDETHIQKLLKDHRKWAKKGSKIVIARRAVTRDLLHEDSMVRYTYFVPLLSHRDGLNHFCHYAFRHFAAHQNNKEAFMKESKEFVRYARGHPLILKLLGEELREKSLSYWEEKLKSLPKSLSQNIRDRVLQVTYDELSQVQKDAFLDIACFRSHDLVYVKSLLDSSGPAFSKATVTIDALKDMFMIYISDSRVEMHDLLYTFAMELGPEARDDDGRGRHRIWHHHNQDNKGRLNRLLKRPGGSTSVRSFFLDMYVMKTDVTLGTDYLKNMRNLRYLKFYSSHCPQECTPKENIHIPGELELPLEEVRCLHWLNFPKDELPQDFIPKNLVDLKLPYSKIRQIWREEKDAPKLRWVDLNHSSKLENLSGLSQALNLERLNLEGCTALKTLLLGPENMASLVFLNLKGCTGLESLPKINLRSLKTLILSNCSNLEEFWVISETLYTLYLDGTAIKTLPQDMVKLTSLVKLYMKDCEMLVKLPEEFDKLKVLQELVCSGCKRLSSLPDVMKNMQCLQILLLDGTAITKIPHISSLERLCLSRNEKISCLSNDIRLLSQLKWLDLKYCTKLVSIPELPTNLQCLDANGCESLTTVANPLATHLPTEQIHSTFIFTNCDKLDRTAKEGFVPEALFSTCFPGCEVPSWFCHEAVGSVLKLNLLPHWNENRFVGIALCAVVGSLPNCQEQTNSCSVTCTFNIASKDSKKGDPYKISFDRLVGRWNKHGNKLDKKGNKLKKTESDHVFICYTRCSNSIKCLQDQHSGTCTPTEAFLEFGVTDKESRLEVLKCGLRLVYASDEPQKTNSDMDLSLSSSDSTPTRNGSSNTTTSSGSVSTNTIREEDSNILHEAQSQNGRGL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TSSSVVSSVPQQHQVFLNFRGDELRNNFVSHLDKALRGKQINVFIDEAVEKGENLDNLFKEIEKSRIALAIISQKYTESKWCLNELVKMKELEGKLVTIPIFYNVEPATVRYQKEAFGAALTKTQENDSDGQMKKWKEALTYVSLLVGF

ProfileScan: PS50104
IPR000157
13-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QQHQVFLNFRGDELRNNFVSHLDKALRGKQINVFIDEAVEKGENLDNLFKEIEKSRIALAIISQKYTESKWCLNELVKMKELEGKLVTIPIFYNVEPATVRYQKEAFGAALTKTQENDSDGQMKKWKEALTYVSLL

Gene3D: G3DSA:3.40.50.10140
13-142 G3DSA:3.40.50.10140

QQHQVFLNFRGDELRNNFVSHLDKALRGKQINVFIDEAVEKGENLDNLFKEIEKSRIALAIISQKYTESKWCLNELVKMKELEGKLVTIPIFYNVEPATVRYQKEAFGAALTKTQENDSDGQMKKWKEAL

HMMSmart: SM00255
IPR000157
14-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QHQVFLNFRGDELRNNFVSHLDKALRGKQINVFIDEAVEKGENLDNLFKEIEKSRIALAIISQKYTESKWCLNELVKMKELEGKLVTIPIFYNVEPATVRYQKEAFGAALTKTQENDSDGQMKKWKEALTYVSLL

HMMPfam: PF01582
IPR000157
17-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLNFRGDELRNNFVSHLDKALRGKQINVFIDEAVEKGENLDNLFKEIEKSRIALAIISQKYTESKWCLNELVKMKELEGKLVTIPIFYNVEPATVRYQKEAFGAALTKTQENDSDGQMKKWKEALT

HMMPanther: PTHR23155:SF67
24-943 PTHR23155:SF67,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

DELRNNFVSHLDKALRGKQINVFIDEAVEKGENLDNLFKEIEKSRIALAIISQKYTESKWCLNELVKMKELEGKLVTIPIFYNVEPATVRYQKEAFGAALTKTQENDSDGQMKKWKEALTYVSLLVGFPFNSKSKEKETTLIDKIVDAVLQKLSKISSEESTSGSVDQGRGEEVEEAKADKISGLNQRLKELEEKVAITGDKRDETRIVEVVGMPGIGKSTLLKAFYETWKTRFLSSALLQNISELVKAMGLGRLTGMLLKELLPDENIDEETYEPYKEKLLKNTVFIVLDGISDETHIQKLLKDHRKWAKKGSKIVIARRAVTRDLLHEDSMVRYTYFVPLLSHRDGLNHFCHYAFRHFAAHQNNKEAFMKESKEFVRYARGHPLILKLLGEELREKSLSYWEEKLKSLPKSLSQNIRDRVLQVTYDELSQVQKDAFLDIACFRSHDLVYVKSLLDSSGPAFSKATVTIDALKDMFMIYISDSRVEMHDLLYTFAMELGPEARDDDGRGRHRIWHHHNQDNKGRLNRLLKRPGGSTSVRSFFLDMYVMKTDVTLGTDYLKNMRNLRYLKFYSSHCPQECTPKENIHIPGELELPLEEVRCLHWLNFPKDELPQDFIPKNLVDLKLPYSKIRQIWREEKDAPKLRWVDLNHSSKLENLSGLSQALNLERLNLEGCTALKTLLLGPENMASLVFLNLKGCTGLESLPKINLRSLKTLILSNCSNLEEFWVISETLYTLYLDGTAIKTLPQDMVKLTSLVKLYMKDCEMLVKLPEEFDKLKVLQELVCSGCKRLSSLPDVMKNMQCLQILLLDGTAITKIPHISSLERLCLSRNEKISCLSNDIRLLSQLKWLDLKYCTKLVSIPELPTNLQCLDANGCESLTTVANPLATHLPTEQIHSTFIFTNCDKLDRTAKEGFVPEA

HMMPanther: PTHR23155
24-943 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DELRNNFVSHLDKALRGKQINVFIDEAVEKGENLDNLFKEIEKSRIALAIISQKYTESKWCLNELVKMKELEGKLVTIPIFYNVEPATVRYQKEAFGAALTKTQENDSDGQMKKWKEALTYVSLLVGFPFNSKSKEKETTLIDKIVDAVLQKLSKISSEESTSGSVDQGRGEEVEEAKADKISGLNQRLKELEEKVAITGDKRDETRIVEVVGMPGIGKSTLLKAFYETWKTRFLSSALLQNISELVKAMGLGRLTGMLLKELLPDENIDEETYEPYKEKLLKNTVFIVLDGISDETHIQKLLKDHRKWAKKGSKIVIARRAVTRDLLHEDSMVRYTYFVPLLSHRDGLNHFCHYAFRHFAAHQNNKEAFMKESKEFVRYARGHPLILKLLGEELREKSLSYWEEKLKSLPKSLSQNIRDRVLQVTYDELSQVQKDAFLDIACFRSHDLVYVKSLLDSSGPAFSKATVTIDALKDMFMIYISDSRVEMHDLLYTFAMELGPEARDDDGRGRHRIWHHHNQDNKGRLNRLLKRPGGSTSVRSFFLDMYVMKTDVTLGTDYLKNMRNLRYLKFYSSHCPQECTPKENIHIPGELELPLEEVRCLHWLNFPKDELPQDFIPKNLVDLKLPYSKIRQIWREEKDAPKLRWVDLNHSSKLENLSGLSQALNLERLNLEGCTALKTLLLGPENMASLVFLNLKGCTGLESLPKINLRSLKTLILSNCSNLEEFWVISETLYTLYLDGTAIKTLPQDMVKLTSLVKLYMKDCEMLVKLPEEFDKLKVLQELVCSGCKRLSSLPDVMKNMQCLQILLLDGTAITKIPHISSLERLCLSRNEKISCLSNDIRLLSQLKWLDLKYCTKLVSIPELPTNLQCLDANGCESLTTVANPLATHLPTEQIHSTFIFTNCDKLDRTAKEGFVPEA

Gene3D: G3DSA:3.40.50.300
208-341 G3DSA:3.40.50.300

LNQRLKELEEKVAITGDKRDETRIVEVVGMPGIGKSTLLKAFYETWKTRFLSSALLQNISELVKAMGLGRLTGMLLKELLPDENIDEETYEPYKEKLLKNTVFIVLDGISDETHIQKLLKDHRKWAKKGSKIVI

HMMPfam: PF00931
IPR002182
226-478 NB-ARC,NBS
NB-ARC

RDETRIVEVVGMPGIGKSTLLKAFYETWKTRFLSSALLQNISELVKAMGLGRLTGMLLKELLPDENIDEETYEPYKEKLLKNTVFIVLDGISDETHIQKLLKDHRKWAKKGSKIVIARRAVTRDLLHEDSMVRYTYFVPLLSHRDGLNHFCHYAFRHFAAHQNNKEAFMKESKEFVRYARGHPLILKLLGEELREKSLSYWEEKLKSLPKSLSQNIRDRVLQVTYDELSQVQKDAFLDIACFRSHDLVYVKSL

superfamily: SSF52540
227-441 SSF52540

DETRIVEVVGMPGIGKSTLLKAFYETWKTRFLSSALLQNISELVKAMGLGRLTGMLLKELLPDENIDEETYEPYKEKLLKNTVFIVLDGISDETHIQKLLKDHRKWAKKGSKIVIARRAVTRDLLHEDSMVRYTYFVPLLSHRDGLNHFCHYAFRHFAAHQNNKEAFMKESKEFVRYARGHPLILKLLGEELREKSLSYWEEKLKSLPKSLSQNI

FPrintScan: PR00364
IPR000767
231-246 DISEASERSIST
Disease resistance protein

IVEVVGMPGIGKSTLL

FPrintScan: PR00364
IPR000767
303-317 DISEASERSIST
Disease resistance protein

KLLKNTVFIVLDGIS

FPrintScan: PR00364
IPR000767
404-418 DISEASERSIST
Disease resistance protein

ARGHPLILKLLGEEL

superfamily: SSF52058
510-953 SSF52058,LRR

EMHDLLYTFAMELGPEARDDDGRGRHRIWHHHNQDNKGRLNRLLKRPGGSTSVRSFFLDMYVMKTDVTLGTDYLKNMRNLRYLKFYSSHCPQECTPKENIHIPGELELPLEEVRCLHWLNFPKDELPQDFIPKNLVDLKLPYSKIRQIWREEKDAPKLRWVDLNHSSKLENLSGLSQALNLERLNLEGCTALKTLLLGPENMASLVFLNLKGCTGLESLPKINLRSLKTLILSNCSNLEEFWVISETLYTLYLDGTAIKTLPQDMVKLTSLVKLYMKDCEMLVKLPEEFDKLKVLQELVCSGCKRLSSLPDVMKNMQCLQILLLDGTAITKIPHISSLERLCLSRNEKISCLSNDIRLLSQLKWLDLKYCTKLVSIPELPTNLQCLDANGCESLTTVANPLATHLPTEQIHSTFIFTNCDKLDRTAKEGFVPEALFSTCFPGCE

Gene3D: G3DSA:3.80.10.10
625-760 G3DSA:3.80.10.10

LHWLNFPKDELPQDFIPKNLVDLKLPYSKIRQIWREEKDAPKLRWVDLNHSSKLENLSGLSQALNLERLNLEGCTALKTLLLGPENMASLVFLNLKGCTGLESLPKINLRSLKTLILSNCSNLEEFWVISETLYTL

HMMPfam: PF07725
IPR011713
643-662 LRR_3
Leucine-rich repeat 3

NLVDLKLPYSKIRQIWREEK

FPrintScan: PR00364
IPR000767
731-747 DISEASERSIST
Disease resistance protein

INLRSLKTLILSNCSNL

Gene3D: G3DSA:3.80.10.10
761-910 G3DSA:3.80.10.10

YLDGTAIKTLPQDMVKLTSLVKLYMKDCEMLVKLPEEFDKLKVLQELVCSGCKRLSSLPDVMKNMQCLQILLLDGTAITKIPHISSLERLCLSRNEKISCLSNDIRLLSQLKWLDLKYCTKLVSIPELPTNLQCLDANGCESLTTVANPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox