PRGDB00047073 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186516775 (NM_119782)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT4G36150) mRNA, complete cds.

DNA Sequence

ATGGTGGATTATTCTTCTTCTTCTTCTTCATCCGTTCAATTATCTCCGCCGCAGCATCAAGTCTTCCTCAATTTCCGAGGGAAACAACTGCGGAACGGTTTCGTCAGCCATCTGGAGAAAGCCTTGAGGAGGGATGGAATCAACGTCTTTATCGACAGAAACGAAACCAAAGGTAGAGATCTCAGTAACCTTTTCTCGAGAATCCAGGAGTCGAGGATCGCGCTCGCCATTTTCTCTAGCATGTATACGGAGTCGTATTGGTGCTTGGACGAGCTTGTGAAGATTAAGGATTGTGTTGACTTAGGCACACTTGTCGTTATTCCCATCTTCTACATGGTGGACACAGACGATGTCAAAAACCTAAAGGGCGCTTTTGGTTACACGTTCTGGAAATTGGCTAAGACTTGTAATGGTGAAAAGCTCGATAAGTGGAAACAAGCTTTAAAGGATGTTCCTAAAAAGCTTGGCTTTACGTTGAGCGAAATGAGCGATGAAGGCGAATCCATCAATCAAATTGTAGGGGAAGTCATAAAGGTGCTATCATCTGATGTTATGCCTGATCTAGAAAGGGAAATCCCCATTGATGATCCTTTTCCAACAGGAGAACAAGTACCTGAAGCTGCTCCTGACTCGCCTCCTCCTCTGTTTGGCATTGAAACACGACTTAAGCAATTGGAAGAGAAGTTGGATTTTGAGTGCAAGGATACTCTTACCATTGGTGTTGTTGGGATGCCTGGTATTGGTAAGACCACTCTGACTAGTATGCTTTATGAAAAGTGGCAACACGATTTCCTACGCTGTGTTTTTCTTCATGATGTCCGTAAGATGTGGAAAGACTGCATGATGGATCGGAGCATTTTCATTGAAGAGTTGTTGAAGGATGATAACGTGAACCAAGAAGTCGCTGACTTTTCACCTGAATCCTTGAAGGCACTCCTACTGAGTAAGAAATCTCTTGTTGTTCTTGATAATGTGAGCGACAAGAAACAGATAGAGGTTCTTCTCGGGGAATCAGACTGGATTAAGAGAGGTAGTAGAATCTTTATCACAACTAGCGACAGGTCGGTGATCGAGGGGATGGTTGATGATACATATGAGGTCCTGAGATTGACTGGTAGAGACAGCTTTGAGTACTTTAGCTATTTTGCCTTTAGTGGTAAGCTTTGTCCTCCAGTGAGAACTTTCATGAATCTGTCTAGATTGTTTGCGGATTATGCTAAAGGCAACCCATTAGCTCTCAAGATATTGGGTAAGGAGCTAAATGGAAAAGACAAGACTCACTGGGAAGAGAAACTTAGCAAGCTGATGCAAAGTCCCAATAAGACAATACAAGATGTCTTGCGGGTAAGCTATGATGAACTAGGTTTGTCTCACAAAGATGTCTTTCTTGATGTCGCATGTTTCTTTAGATCAGGGGATGAGTATTACGTGAGGTGTTTAGTGGAATCTTGTGACACTGAAGCCATTGATACTGTGAGTGAAATAAAGGATCTTGCCAGCAAATTCTTGATAAACATTTCTGGCGGACGAGTGGAGATGCATGATTTACTGTATACATTTGGTAAGGAACTTGGTTCACAAGGGTCGCGTAGGCTGTGGAACCATAAAGCCGTTGTAGGTGCGCTGAAGAATAGAGTGGGAGCCGTGAGAGGTATTTTTCTTGACATGTCTGAACTGAAGAAGAAACTTCCTTTGGACAGAAGTACCTTCATCAAGATGCGCAATCTTAGATACCTCAAATTCTATAGTTCTCGTTGTGATCGAGAATGTGAAGCTGATAGCAAACTAAACTTTCCGGAGGGACTTGAGTTTCCGTTGGATGAGATACGTTACCTCTATTGGCTAAAATTCCCGTTGATGAAACTTCCAAAAGACTTCAACCCCAAGAATCTTACCGACTTTAACCTGCCTTACAGCGAGATTGAAGAGCTCTGGGAGGGGGCTAAGGATACACAGAAGTTAAAGTGGGTTGATCTTAGCCACTCAAGAAAGTTATGCAATCTGTCAGGGTTGCTAAATGCTGAGAGTCTCCAAAGACTAAATCTTGAAGGGTGCACGAGTTTGGAGGAGTTGCCTCGTGAGATGAAACGCATGAAAAGCCTTATTTTCCTCAACATGAGAGGATGCACGAGTCTCCGGGTTCTTCCGCGTATGAATCTGATCTCTTTGAAAACTCTCATCCTCACCAATTGCTCAAGCATTCAGAAATTCCAGGTGATTTCAGATAACCTAGAAACTCTACACTTAGATGGAACTGCAATTGGCAAACTTCCTACCGACATGGTGAAGCTCCAGAAACTGATTGTATTGAACTTGAAAGACTGCAAAATGTTAGGTGCAGTTCCAGAATTCCTAGGGAAGCTGAAAGCTCTGCAAGAACTGGTGCTATCTGGTTGTTCAAAGCTCAAGACTTTTTCAGTTCCTATTGAAACCATGAAATGCTTGCAGATATTATTGCTTGACGGGACAGCACTTAAAGAAATGCCAAAGTTATTGCGGTTCAATAGCTCTAGAGTGGAAGATCTACCCGAATTAAGACGTGGTATTAATGGCCTATCCTCATTGCGACGTCTATGCTTAAGCAGGAACAATATGATCAGCAATCTGCAAATCGACATCAATCAACTCTATCATCTGAAATGGTTAGACCTGAAATACTGCAAGAATCTCACATCAATTCCATTGCTTCCACCAAATCTAGAGATCTTAGATGCACATGGCTGCGAAAAACTGAAAACAGTTGCGTCGCCCATGGCCCTTCTTAAGCTTATGGAGCAGGTTCAGTCTAAATTCATTTTCACCAACTGCAACAATCTGGAACAAGTTGCAAAGAATAGCATCACATCGTATGCTCAAAGGAAAAGCCAGCTAGATGCACGTAGATGCTACAAAGAGGGGGGTGTTTCAGAAGCTTTGTTCATCGCTTGCTTTCCAGGAAGTGATGTACCTTCATGGTTCAACTATCAAACATTTGGATCCGCATTAAGGCTGAAGTTGCCGCCACATTGGTGTGACAACAGGCTTTCAACAATAGCTCTATGTGCTGTTGTCACATTCCCTGACACTCAAGATGAAATCAACCGTTTCTCAATAGAGTGCACTTGTGAGTTCAAAAATGAACTTGGGACATGTATACGTTTCAGTTGCACTCTTGGTGGAAGTTGGATCGAGTCTCGCAAGATTGATTCAGATCATGTGTTTATCGGTTACACTAGTAGCTCACACATAACAAAACATCTAGAAGGGTCGTTGAAGTTGAAAGAACATGATAAATGTGTTCCTACGGAGGCTTCAATCGAATTTGAAGTGATAGATGGAGCAGGTGAAATTGTGAATTGTGGTTTAAGTTTGGTGTACGAGGAACCAAACCATGTCGTTGTTGAAAGGAACTGTAAAGGAGCTTCATCAAGAAGAGATATGTCCGTTGGAGAGAGCATATTGAGCATTGCTGCTGGGTATTTGTCCAATGTTTTGAGGTTTCTGTGGCTAGGTGTTGTATTCTTTATGGTTTATGGATTTTCTAAAATTTTTGTTAAATAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MVDYSSSSSSSVQLSPPQHQVFLNFRGKQLRNGFVSHLEKALRRDGINVFIDRNETKGRDLSNLFSRIQESRIALAIFSSMYTESYWCLDELVKIKDCVDLGTLVVIPIFYMVDTDDVKNLKGAFGYTFWKLAKTCNGEKLDKWKQALKDVPKKLGFTLSEMSDEGESINQIVGEVIKVLSSDVMPDLEREIPIDDPFPTGEQVPEAAPDSPPPLFGIETRLKQLEEKLDFECKDTLTIGVVGMPGIGKTTLTSMLYEKWQHDFLRCVFLHDVRKMWKDCMMDRSIFIEELLKDDNVNQEVADFSPESLKALLLSKKSLVVLDNVSDKKQIEVLLGESDWIKRGSRIFITTSDRSVIEGMVDDTYEVLRLTGRDSFEYFSYFAFSGKLCPPVRTFMNLSRLFADYAKGNPLALKILGKELNGKDKTHWEEKLSKLMQSPNKTIQDVLRVSYDELGLSHKDVFLDVACFFRSGDEYYVRCLVESCDTEAIDTVSEIKDLASKFLINISGGRVEMHDLLYTFGKELGSQGSRRLWNHKAVVGALKNRVGAVRGIFLDMSELKKKLPLDRSTFIKMRNLRYLKFYSSRCDRECEADSKLNFPEGLEFPLDEIRYLYWLKFPLMKLPKDFNPKNLTDFNLPYSEIEELWEGAKDTQKLKWVDLSHSRKLCNLSGLLNAESLQRLNLEGCTSLEELPREMKRMKSLIFLNMRGCTSLRVLPRMNLISLKTLILTNCSSIQKFQVISDNLETLHLDGTAIGKLPTDMVKLQKLIVLNLKDCKMLGAVPEFLGKLKALQELVLSGCSKLKTFSVPIETMKCLQILLLDGTALKEMPKLLRFNSSRVEDLPELRRGINGLSSLRRLCLSRNNMISNLQIDINQLYHLKWLDLKYCKNLTSIPLLPPNLEILDAHGCEKLKTVASPMALLKLMEQVQSKFIFTNCNNLEQVAKNSITSYAQRKSQLDARRCYKEGGVSEALFIACFPGSDVPSWFNYQTFGSALRLKLPPHWCDNRLSTIALCAVVTFPDTQDEINRFSIECTCEFKNELGTCIRFSCTLGGSWIESRKIDSDHVFIGYTSSSHITKHLEGSLKLKEHDKCVPTEASIEFEVIDGAGEIVNCGLSLVYEEPNHVVVERNCKGASSRRDMSVGESILSIAAGYLSNVLRFLWLGVVFFMVYGFSKIFVK

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
7-157 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSSSVQLSPPQHQVFLNFRGKQLRNGFVSHLEKALRRDGINVFIDRNETKGRDLSNLFSRIQESRIALAIFSSMYTESYWCLDELVKIKDCVDLGTLVVIPIFYMVDTDDVKNLKGAFGYTFWKLAKTCNGEKLDKWKQALKDVPKKLGF

ProfileScan: PS50104
IPR000157
17-154 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PQHQVFLNFRGKQLRNGFVSHLEKALRRDGINVFIDRNETKGRDLSNLFSRIQESRIALAIFSSMYTESYWCLDELVKIKDCVDLGTLVVIPIFYMVDTDDVKNLKGAFGYTFWKLAKTCNGEKLDKWKQALKDVPKK

Gene3D: G3DSA:3.40.50.10140
18-153 G3DSA:3.40.50.10140

QHQVFLNFRGKQLRNGFVSHLEKALRRDGINVFIDRNETKGRDLSNLFSRIQESRIALAIFSSMYTESYWCLDELVKIKDCVDLGTLVVIPIFYMVDTDDVKNLKGAFGYTFWKLAKTCNGEKLDKWKQALKDVPK

HMMSmart: SM00255
IPR000157
18-154 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QHQVFLNFRGKQLRNGFVSHLEKALRRDGINVFIDRNETKGRDLSNLFSRIQESRIALAIFSSMYTESYWCLDELVKIKDCVDLGTLVVIPIFYMVDTDDVKNLKGAFGYTFWKLAKTCNGEKLDKWKQALKDVPKK

HMMPfam: PF01582
IPR000157
21-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLNFRGKQLRNGFVSHLEKALRRDGINVFIDRNETKGRDLSNLFSRIQESRIALAIFSSMYTESYWCLDELVKIKDCVDLGTLVVIPIFYMVDTDDVKNLKGAFGYTFWKLAKTCNGEKLDKWKQALK

HMMPanther: PTHR23155:SF66
28-952 PTHR23155:SF66,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

KQLRNGFVSHLEKALRRDGINVFIDRNETKGRDLSNLFSRIQESRIALAIFSSMYTESYWCLDELVKIKDCVDLGTLVVIPIFYMVDTDDVKNLKGAFGYTFWKLAKTCNGEKLDKWKQALKDVPKKLGFTLSEMSDEGESINQIVGEVIKVLSSDVMPDLEREIPIDDPFPTGEQVPEAAPDSPPPLFGIETRLKQLEEKLDFECKDTLTIGVVGMPGIGKTTLTSMLYEKWQHDFLRCVFLHDVRKMWKDCMMDRSIFIEELLKDDNVNQEVADFSPESLKALLLSKKSLVVLDNVSDKKQIEVLLGESDWIKRGSRIFITTSDRSVIEGMVDDTYEVLRLTGRDSFEYFSYFAFSGKLCPPVRTFMNLSRLFADYAKGNPLALKILGKELNGKDKTHWEEKLSKLMQSPNKTIQDVLRVSYDELGLSHKDVFLDVACFFRSGDEYYVRCLVESCDTEAIDTVSEIKDLASKFLINISGGRVEMHDLLYTFGKELGSQGSRRLWNHKAVVGALKNRVGAVRGIFLDMSELKKKLPLDRSTFIKMRNLRYLKFYSSRCDRECEADSKLNFPEGLEFPLDEIRYLYWLKFPLMKLPKDFNPKNLTDFNLPYSEIEELWEGAKDTQKLKWVDLSHSRKLCNLSGLLNAESLQRLNLEGCTSLEELPREMKRMKSLIFLNMRGCTSLRVLPRMNLISLKTLILTNCSSIQKFQVISDNLETLHLDGTAIGKLPTDMVKLQKLIVLNLKDCKMLGAVPEFLGKLKALQELVLSGCSKLKTFSVPIETMKCLQILLLDGTALKEMPKLLRFNSSRVEDLPELRRGINGLSSLRRLCLSRNNMISNLQIDINQLYHLKWLDLKYCKNLTSIPLLPPNLEILDAHGCEKLKTVASPMALLKLMEQVQSKFIFTNCNNLEQVAKNSITSYAQ

HMMPanther: PTHR23155
28-952 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KQLRNGFVSHLEKALRRDGINVFIDRNETKGRDLSNLFSRIQESRIALAIFSSMYTESYWCLDELVKIKDCVDLGTLVVIPIFYMVDTDDVKNLKGAFGYTFWKLAKTCNGEKLDKWKQALKDVPKKLGFTLSEMSDEGESINQIVGEVIKVLSSDVMPDLEREIPIDDPFPTGEQVPEAAPDSPPPLFGIETRLKQLEEKLDFECKDTLTIGVVGMPGIGKTTLTSMLYEKWQHDFLRCVFLHDVRKMWKDCMMDRSIFIEELLKDDNVNQEVADFSPESLKALLLSKKSLVVLDNVSDKKQIEVLLGESDWIKRGSRIFITTSDRSVIEGMVDDTYEVLRLTGRDSFEYFSYFAFSGKLCPPVRTFMNLSRLFADYAKGNPLALKILGKELNGKDKTHWEEKLSKLMQSPNKTIQDVLRVSYDELGLSHKDVFLDVACFFRSGDEYYVRCLVESCDTEAIDTVSEIKDLASKFLINISGGRVEMHDLLYTFGKELGSQGSRRLWNHKAVVGALKNRVGAVRGIFLDMSELKKKLPLDRSTFIKMRNLRYLKFYSSRCDRECEADSKLNFPEGLEFPLDEIRYLYWLKFPLMKLPKDFNPKNLTDFNLPYSEIEELWEGAKDTQKLKWVDLSHSRKLCNLSGLLNAESLQRLNLEGCTSLEELPREMKRMKSLIFLNMRGCTSLRVLPRMNLISLKTLILTNCSSIQKFQVISDNLETLHLDGTAIGKLPTDMVKLQKLIVLNLKDCKMLGAVPEFLGKLKALQELVLSGCSKLKTFSVPIETMKCLQILLLDGTALKEMPKLLRFNSSRVEDLPELRRGINGLSSLRRLCLSRNNMISNLQIDINQLYHLKWLDLKYCKNLTSIPLLPPNLEILDAHGCEKLKTVASPMALLKLMEQVQSKFIFTNCNNLEQVAKNSITSYAQ

superfamily: SSF52540
197-443 SSF52540

PFPTGEQVPEAAPDSPPPLFGIETRLKQLEEKLDFECKDTLTIGVVGMPGIGKTTLTSMLYEKWQHDFLRCVFLHDVRKMWKDCMMDRSIFIEELLKDDNVNQEVADFSPESLKALLLSKKSLVVLDNVSDKKQIEVLLGESDWIKRGSRIFITTSDRSVIEGMVDDTYEVLRLTGRDSFEYFSYFAFSGKLCPPVRTFMNLSRLFADYAKGNPLALKILGKELNGKDKTHWEEKLSKLMQSPNKTI

Gene3D: G3DSA:3.40.50.300
212-362 G3DSA:3.40.50.300

PPPLFGIETRLKQLEEKLDFECKDTLTIGVVGMPGIGKTTLTSMLYEKWQHDFLRCVFLHDVRKMWKDCMMDRSIFIEELLKDDNVNQEVADFSPESLKALLLSKKSLVVLDNVSDKKQIEVLLGESDWIKRGSRIFITTSDRSVIEGMVD

HMMPfam: PF00931
IPR002182
219-471 NB-ARC,NBS
NB-ARC

ETRLKQLEEKLDFECKDTLTIGVVGMPGIGKTTLTSMLYEKWQHDFLRCVFLHDVRKMWKDCMMDRSIFIEELLKDDNVNQEVADFSPESLKALLLSKKSLVVLDNVSDKKQIEVLLGESDWIKRGSRIFITTSDRSVIEGMVDDTYEVLRLTGRDSFEYFSYFAFSGKLCPPVRTFMNLSRLFADYAKGNPLALKILGKELNGKDKTHWEEKLSKLMQSPNKTIQDVLRVSYDELGLSHKDVFLDVACFFRS

FPrintScan: PR00364
IPR000767
238-253 DISEASERSIST
Disease resistance protein

TIGVVGMPGIGKTTLT

FPrintScan: PR00364
IPR000767
312-326 DISEASERSIST
Disease resistance protein

LLLSKKSLVVLDNVS

FPrintScan: PR00364
IPR000767
406-420 DISEASERSIST
Disease resistance protein

AKGNPLALKILGKEL

superfamily: SSF46785
441-543 SSF46785

KTIQDVLRVSYDELGLSHKDVFLDVACFFRSGDEYYVRCLVESCDTEAIDTVSEIKDLASKFLINISGGRVEMHDLLYTFGKELGSQGSRRLWNHKAVVGALK

superfamily: SSF52058
512-954 SSF52058,LRR

EMHDLLYTFGKELGSQGSRRLWNHKAVVGALKNRVGAVRGIFLDMSELKKKLPLDRSTFIKMRNLRYLKFYSSRCDRECEADSKLNFPEGLEFPLDEIRYLYWLKFPLMKLPKDFNPKNLTDFNLPYSEIEELWEGAKDTQKLKWVDLSHSRKLCNLSGLLNAESLQRLNLEGCTSLEELPREMKRMKSLIFLNMRGCTSLRVLPRMNLISLKTLILTNCSSIQKFQVISDNLETLHLDGTAIGKLPTDMVKLQKLIVLNLKDCKMLGAVPEFLGKLKALQELVLSGCSKLKTFSVPIETMKCLQILLLDGTALKEMPKLLRFNSSRVEDLPELRRGINGLSSLRRLCLSRNNMISNLQIDINQLYHLKWLDLKYCKNLTSIPLLPPNLEILDAHGCEKLKTVASPMALLKLMEQVQSKFIFTNCNNLEQVAKNSITSYAQRK

Gene3D: G3DSA:3.80.10.10
567-726 G3DSA:3.80.10.10

RSTFIKMRNLRYLKFYSSRCDRECEADSKLNFPEGLEFPLDEIRYLYWLKFPLMKLPKDFNPKNLTDFNLPYSEIEELWEGAKDTQKLKWVDLSHSRKLCNLSGLLNAESLQRLNLEGCTSLEELPREMKRMKSLIFLNMRGCTSLRVLPRMNLISLKTL

HMMPfam: PF07725
IPR011713
630-649 LRR_3
Leucine-rich repeat 3

NLTDFNLPYSEIEELWEGAK

FPrintScan: PR00364
IPR000767
718-734 DISEASERSIST
Disease resistance protein

MNLISLKTLILTNCSSI

Gene3D: G3DSA:3.80.10.10
727-849 G3DSA:3.80.10.10

ILTNCSSIQKFQVISDNLETLHLDGTAIGKLPTDMVKLQKLIVLNLKDCKMLGAVPEFLGKLKALQELVLSGCSKLKTFSVPIETMKCLQILLLDGTALKEMPKLLRFNSSRVEDLPELRRGI

HMMPfam: PF13855
743-799 LRR_8,Leucine rich repeat

NLETLHLDGTAIGKLPTDMVKLQKLIVLNLKDCKMLGAVPEFLGKLKALQELVLSGC

Gene3D: G3DSA:3.80.10.10
850-919 G3DSA:3.80.10.10

NGLSSLRRLCLSRNNMISNLQIDINQLYHLKWLDLKYCKNLTSIPLLPPNLEILDAHGCEKLKTVASPMA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox