PRGDB00047074 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18413225 (NM_117011)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT4G09430) mRNA, complete cds.

DNA Sequence

ATGGCTTCCTCATCCACATCCTCTCCAACTCGAGTCAAGGAGTACGATGTCTTCCTCAGCTTTCGAGGGGCGGACACCCGCAATAACATAGTCAGCTATTTGCACAAAGCACTTGTTGATGTCGGAATCCGTACCTTCAAAGACGACAAGGAGCTTGAAGAAGGCGACATCATTTCTGAAAAACTTGTCAACGCTATACAAACTTCGTGGTTTGCTGTGGTTGTTCTCTCAGAAAAATATGTTACTTCAAGTTGGTGTTTGGAGGAACTCCGACATATAATGGAGCTTTCCATTCAGGATGACATTATAGTCGTTCCCATCTTTTATAAAGTAGAACCTTCAGACGTGAGATACCAGAAAAATAGCTTCGAGGTTAAGCTTCAGCACTACAGAGATCCAGAGAAGATTCTCAAATGGAAGGGAGCTCTCACTCAAGTTGGCAATATGTCAGGCAAGCATTTCCAGACATGTTCCGATGAGGCAACGAACATCGCAGAGATAGTTTCAAAAATTTCAAACCGACTGAGAAAGATGAAGCCTACAGATCTAATCAATTTAGTTGGAATGGATGCTCATATGGAGAAGATGCAACTCCTTTTGGATAAGGAGCCTAAAAGTGAGGTTAGAATGATAGGGATATTGGGTATGGGAGGCATAGGCAAGACCGCCATTGCCAACTATCTCTATAACCAATTCTCACATGAATATTGGGCACACTGTTTCATAGAAGACGCTTGGAACACCAATGACCCAACTCACCTACAAAGGAAATTGCTTTCCCATATCTGCAATGATGAAAATGCCAAGTTGTTTACCAGGGAAGCTGGAGCCATGAAGATTAAGGGTATACTTAAGCACAAGAAATTTTTTCTTGTGATAGATGGTGTGAATAAAGCAGAGCAAGTACATGCACTGGCAAAAGAGAGAAGCTGGTTTGGTCCAGGGAGCTTGATCATCATAACTACTCGAGATAGAGGTCTCCTCAATTCATGTGGAGTAAATAATGTATATGAGGTTAAGTGCTTGGATAGTAAGGATGCCCTCCAGGTTTTTGAAAAGTTTGCTTTTGGAGGAAGAAATCCTCCATTTCATGGTTCAGAGAGACTCTTTACCAGAGCTTCTCAGCTTGCTCACGGCCTACCTTATGCCCTTGTAGCTTTTGCTTCGCATCTCAGTGAACAGACCACCATAGAGGGATGGGAAGATGAATTATTTCGTCTAGAAGATTATCCTCAGAAGAATGTTGAAGAAATTTTGAGAGCTAGCTATGATGATTTAGATTATTACGAGCAGTCTGTTTTCCTTCAAGTGGCATGTCTCTTCAACGGAAGCTTTCTCTGGCTTATCAGAGCTTTTCTTGGGAAACTTGGTTCAAGGATAAATAGCTTACGGGCAAAGTCTCTCCTGGACATATCAAATGATGGACGTTTAATCATGCATTTCTTGGTTGAACAAATAGGAAAAGAAATTGTGCGCCAACAATCCAACTGTATACCTTCCGAGCAAAAGTTCTTGTGGAAGCCGGAAGAGATCTATGATGTACTCGCAAGGAACATATTTTTAAAGCATGTGGTTGATATAACGTCCAAGCTGCAGCTCATTTCGGATGTTTCTAGTATCACTCATGGACTTAAGTTACTCCATTGGGACGCCTACCCTCTGGAAACCTTGCCTTTTAGTTTCCAATCAAGCACCCTAGTCGAAATCAATCTGCGATACAGCAACCTAAAACACTTTTGGGATGAAACCAAGGTCTATAGATCCAAGCAGCTTCCGAACCTACGAAGACTAGATGTGACAGGCTCTACGAGTCTAGTAGAACTTCCAGATCTTTCAGATTCCATGAATCTTGAGGAGTTGATAATGGAAGGCTGCAGGAGCCTTAGGCAAACCCCATGGTCCTTAAACAGATTACCTTTGAGGAAACTCAATATGGTCAAGTGTGATAGCCTTATGGGTCTCTTGCTGGTTACTGACGACCATAATCAACCCAAGGCCAGCCGACCCAGCCCCTATCGACATATTAATTTGTTGCTTCTTGATACAGTAACAGCGCTTAGTTCTCTTACAGAATTATCCATCCAAGGCGAAATATCTGTTAAGTTATTGCACACTCTCATAGGAAGTGCAGAGCACTTGTCTTTTACTTGCGAGCAACAGATCCCTGATCAATTGAAAATTACGATGGCACAGAAAACAGGTTCAATTCAACCCTTGCACCTTATCAAAACACTCGTCATTGAGAGGTTCAACTACGGGGCGAGAGAAGCTCCTTTCAGTTGTCAGAGCTTTTCAAGCTTTCCTTGTTTGACTGAGCTAAAGCTCATCAACTTAAGCATCCGAGAAATCCCACAAGACATTGATTGTTTGTTGTCCTTAAGGAAAATGGACCTCACCGGTAATGATTTCGTTCATCTACCCAAAACCATGGCACAACTGACCAAGCTGGAATGTCTTACTCTTCGAAACTGCCGTCAGCTCAAAGCATTGCCACTACTTACTCCCACCCTCACTCTTCCTGGTCTAGACAACCAACCGAGGGGTTTGATAGAGCTTTGCATTGACAACTGCAAGAATCTTCAGTCACTGCAAGATCAGCTATTATGCTATAACACCAGTTTAGCATATTTAGACCTTAGCAACCATGATTTCGAGAGAATACCAACAAGCATTAGACACCTGTCCTCACTGAACACTCTCTGCCTCAAGAACTGCAAGAAACTCAAATATGTGGAAGAGCTTCCCCTGAGTCTCAACCATCTCTATGCACACGGCTGTGATTATCTGGAGAACGTCACCCTTTCCCCAAACCATACGATCAAACACCTCGATCTTAGAGATTGCCCCCGCCTGAAACAAAGCGAGCAGATAAAGACTCTGGTTTCAAACGAGAGACATGGTGAAGCGTTTGGCTTACGTTCCGGTTCGAGTGGGTTTTCCAATTATAGCCAAAATCCTAAAACCAGCGGCAGAGAAATTCCAAAGACCGCTTTACCAAAGCTTGGTCTGCAACTCAAATTGCCACAAACACATACTGAGATTGTTATTTTATGTGGAGCTCGCTTGACCACAAACAAAATCAACATGGAGCATCATTTTTCTTGCCATTTTATTTTATAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSTSSPTRVKEYDVFLSFRGADTRNNIVSYLHKALVDVGIRTFKDDKELEEGDIISEKLVNAIQTSWFAVVVLSEKYVTSSWCLEELRHIMELSIQDDIIVVPIFYKVEPSDVRYQKNSFEVKLQHYRDPEKILKWKGALTQVGNMSGKHFQTCSDEATNIAEIVSKISNRLRKMKPTDLINLVGMDAHMEKMQLLLDKEPKSEVRMIGILGMGGIGKTAIANYLYNQFSHEYWAHCFIEDAWNTNDPTHLQRKLLSHICNDENAKLFTREAGAMKIKGILKHKKFFLVIDGVNKAEQVHALAKERSWFGPGSLIIITTRDRGLLNSCGVNNVYEVKCLDSKDALQVFEKFAFGGRNPPFHGSERLFTRASQLAHGLPYALVAFASHLSEQTTIEGWEDELFRLEDYPQKNVEEILRASYDDLDYYEQSVFLQVACLFNGSFLWLIRAFLGKLGSRINSLRAKSLLDISNDGRLIMHFLVEQIGKEIVRQQSNCIPSEQKFLWKPEEIYDVLARNIFLKHVVDITSKLQLISDVSSITHGLKLLHWDAYPLETLPFSFQSSTLVEINLRYSNLKHFWDETKVYRSKQLPNLRRLDVTGSTSLVELPDLSDSMNLEELIMEGCRSLRQTPWSLNRLPLRKLNMVKCDSLMGLLLVTDDHNQPKASRPSPYRHINLLLLDTVTALSSLTELSIQGEISVKLLHTLIGSAEHLSFTCEQQIPDQLKITMAQKTGSIQPLHLIKTLVIERFNYGAREAPFSCQSFSSFPCLTELKLINLSIREIPQDIDCLLSLRKMDLTGNDFVHLPKTMAQLTKLECLTLRNCRQLKALPLLTPTLTLPGLDNQPRGLIELCIDNCKNLQSLQDQLLCYNTSLAYLDLSNHDFERIPTSIRHLSSLNTLCLKNCKKLKYVEELPLSLNHLYAHGCDYLENVTLSPNHTIKHLDLRDCPRLKQSEQIKTLVSNERHGEAFGLRSGSSGFSNYSQNPKTSGREIPKTALPKLGLQLKLPQTHTEIVILCGARLTTNKINMEHHFSCHFIL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSTSSPTRVKEYDVFLSFRGADTRNNIVSYLHKALVDVGIRTFKDDKELEEGDIISEKLVNAIQTSWFAVVVLSEKYVTSSWCLEELRHIMELSIQDDIIVVPIFYKVEPSDVRYQKNSFEVKLQHYRDPEKILKWKGALTQVGNMSGK

Gene3D: G3DSA:3.40.50.10140
12-129 G3DSA:3.40.50.10140

VKEYDVFLSFRGADTRNNIVSYLHKALVDVGIRTFKDDKELEEGDIISEKLVNAIQTSWFAVVVLSEKYVTSSWCLEELRHIMELSIQDDIIVVPIFYKVEPSDVRYQKNSFEVKLQH

ProfileScan: PS50104
IPR000157
13-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KEYDVFLSFRGADTRNNIVSYLHKALVDVGIRTFKDDKELEEGDIISEKLVNAIQTSWFAVVVLSEKYVTSSWCLEELRHIMELSIQDDIIVVPIFYKVEPSDVRYQKNSFEVKLQHYRDPEKILKWKGALTQVGNM

HMMSmart: SM00255
IPR000157
14-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EYDVFLSFRGADTRNNIVSYLHKALVDVGIRTFKDDKELEEGDIISEKLVNAIQTSWFAVVVLSEKYVTSSWCLEELRHIMELSIQDDIIVVPIFYKVEPSDVRYQKNSFEVKLQHYRDPEKILKWKGALTQVGNM

HMMPfam: PF01582
IPR000157
17-144 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGADTRNNIVSYLHKALVDVGIRTFKDDKELEEGDIISEKLVNAIQTSWFAVVVLSEKYVTSSWCLEELRHIMELSIQDDIIVVPIFYKVEPSDVRYQKNSFEVKLQHYRDPEKILKWKGALT

HMMPanther: PTHR23155:SF346
26-970 PTHR23155:SF346

TRNNIVSYLHKALVDVGIRTFKDDKELEEGDIISEKLVNAIQTSWFAVVVLSEKYVTSSWCLEELRHIMELSIQDDIIVVPIFYKVEPSDVRYQKNSFEVKLQHYRDPEKILKWKGALTQVGNMSGKHFQTCSDEATNIAEIVSKISNRLRKMKPTDLINLVGMDAHMEKMQLLLDKEPKSEVRMIGILGMGGIGKTAIANYLYNQFSHEYWAHCFIEDAWNTNDPTHLQRKLLSHICNDENAKLFTREAGAMKIKGILKHKKFFLVIDGVNKAEQVHALAKERSWFGPGSLIIITTRDRGLLNSCGVNNVYEVKCLDSKDALQVFEKFAFGGRNPPFHGSERLFTRASQLAHGLPYALVAFASHLSEQTTIEGWEDELFRLEDYPQKNVEEILRASYDDLDYYEQSVFLQVACLFNGSFLWLIRAFLGKLGSRINSLRAKSLLDISNDGRLIMHFLVEQIGKEIVRQQSNCIPSEQKFLWKPEEIYDVLARNIFLKHVVDITSKLQLISDVSSITHGLKLLHWDAYPLETLPFSFQSSTLVEINLRYSNLKHFWDETKVYRSKQLPNLRRLDVTGSTSLVELPDLSDSMNLEELIMEGCRSLRQTPWSLNRLPLRKLNMVKCDSLMGLLLVTDDHNQPKASRPSPYRHINLLLLDTVTALSSLTELSIQGEISVKLLHTLIGSAEHLSFTCEQQIPDQLKITMAQKTGSIQPLHLIKTLVIERFNYGAREAPFSCQSFSSFPCLTELKLINLSIREIPQDIDCLLSLRKMDLTGNDFVHLPKTMAQLTKLECLTLRNCRQLKALPLLTPTLTLPGLDNQPRGLIELCIDNCKNLQSLQDQLLCYNTSLAYLDLSNHDFERIPTSIRHLSSLNTLCLKNCKKLKYVEELPLSLNHLYAHGCDYLENVTLSPNHTIKHLDLRDCPRLKQSEQIKTLVSNERHGEAF

HMMPanther: PTHR23155
26-970 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRNNIVSYLHKALVDVGIRTFKDDKELEEGDIISEKLVNAIQTSWFAVVVLSEKYVTSSWCLEELRHIMELSIQDDIIVVPIFYKVEPSDVRYQKNSFEVKLQHYRDPEKILKWKGALTQVGNMSGKHFQTCSDEATNIAEIVSKISNRLRKMKPTDLINLVGMDAHMEKMQLLLDKEPKSEVRMIGILGMGGIGKTAIANYLYNQFSHEYWAHCFIEDAWNTNDPTHLQRKLLSHICNDENAKLFTREAGAMKIKGILKHKKFFLVIDGVNKAEQVHALAKERSWFGPGSLIIITTRDRGLLNSCGVNNVYEVKCLDSKDALQVFEKFAFGGRNPPFHGSERLFTRASQLAHGLPYALVAFASHLSEQTTIEGWEDELFRLEDYPQKNVEEILRASYDDLDYYEQSVFLQVACLFNGSFLWLIRAFLGKLGSRINSLRAKSLLDISNDGRLIMHFLVEQIGKEIVRQQSNCIPSEQKFLWKPEEIYDVLARNIFLKHVVDITSKLQLISDVSSITHGLKLLHWDAYPLETLPFSFQSSTLVEINLRYSNLKHFWDETKVYRSKQLPNLRRLDVTGSTSLVELPDLSDSMNLEELIMEGCRSLRQTPWSLNRLPLRKLNMVKCDSLMGLLLVTDDHNQPKASRPSPYRHINLLLLDTVTALSSLTELSIQGEISVKLLHTLIGSAEHLSFTCEQQIPDQLKITMAQKTGSIQPLHLIKTLVIERFNYGAREAPFSCQSFSSFPCLTELKLINLSIREIPQDIDCLLSLRKMDLTGNDFVHLPKTMAQLTKLECLTLRNCRQLKALPLLTPTLTLPGLDNQPRGLIELCIDNCKNLQSLQDQLLCYNTSLAYLDLSNHDFERIPTSIRHLSSLNTLCLKNCKKLKYVEELPLSLNHLYAHGCDYLENVTLSPNHTIKHLDLRDCPRLKQSEQIKTLVSNERHGEAF

superfamily: SSF52540
169-415 SSF52540

SKISNRLRKMKPTDLINLVGMDAHMEKMQLLLDKEPKSEVRMIGILGMGGIGKTAIANYLYNQFSHEYWAHCFIEDAWNTNDPTHLQRKLLSHICNDENAKLFTREAGAMKIKGILKHKKFFLVIDGVNKAEQVHALAKERSWFGPGSLIIITTRDRGLLNSCGVNNVYEVKCLDSKDALQVFEKFAFGGRNPPFHGSERLFTRASQLAHGLPYALVAFASHLSEQTTIEGWEDELFRLEDYPQKNV

Gene3D: G3DSA:3.40.50.300
180-330 G3DSA:3.40.50.300

PTDLINLVGMDAHMEKMQLLLDKEPKSEVRMIGILGMGGIGKTAIANYLYNQFSHEYWAHCFIEDAWNTNDPTHLQRKLLSHICNDENAKLFTREAGAMKIKGILKHKKFFLVIDGVNKAEQVHALAKERSWFGPGSLIIITTRDRGLLNS

HMMPfam: PF00931
IPR002182
190-442 NB-ARC,NBS
NB-ARC

DAHMEKMQLLLDKEPKSEVRMIGILGMGGIGKTAIANYLYNQFSHEYWAHCFIEDAWNTNDPTHLQRKLLSHICNDENAKLFTREAGAMKIKGILKHKKFFLVIDGVNKAEQVHALAKERSWFGPGSLIIITTRDRGLLNSCGVNNVYEVKCLDSKDALQVFEKFAFGGRNPPFHGSERLFTRASQLAHGLPYALVAFASHLSEQTTIEGWEDELFRLEDYPQKNVEEILRASYDDLDYYEQSVFLQVACLFN

FPrintScan: PR00364
IPR000767
210-225 DISEASERSIST
Disease resistance protein

MIGILGMGGIGKTAIA

FPrintScan: PR00364
IPR000767
283-297 DISEASERSIST
Disease resistance protein

ILKHKKFFLVIDGVN

FPrintScan: PR00364
IPR000767
377-391 DISEASERSIST
Disease resistance protein

AHGLPYALVAFASHL

superfamily: SSF46785
413-516 SSF46785

KNVEEILRASYDDLDYYEQSVFLQVACLFNGSFLWLIRAFLGKLGSRINSLRAKSLLDISNDGRLIMHFLVEQIGKEIVRQQSNCIPSEQKFLWKPEEIYDVLA

superfamily: SSF52058
493-967 SSF52058,LRR

QQSNCIPSEQKFLWKPEEIYDVLARNIFLKHVVDITSKLQLISDVSSITHGLKLLHWDAYPLETLPFSFQSSTLVEINLRYSNLKHFWDETKVYRSKQLPNLRRLDVTGSTSLVELPDLSDSMNLEELIMEGCRSLRQTPWSLNRLPLRKLNMVKCDSLMGLLLVTDDHNQPKASRPSPYRHINLLLLDTVTALSSLTELSIQGEISVKLLHTLIGSAEHLSFTCEQQIPDQLKITMAQKTGSIQPLHLIKTLVIERFNYGAREAPFSCQSFSSFPCLTELKLINLSIREIPQDIDCLLSLRKMDLTGNDFVHLPKTMAQLTKLECLTLRNCRQLKALPLLTPTLTLPGLDNQPRGLIELCIDNCKNLQSLQDQLLCYNTSLAYLDLSNHDFERIPTSIRHLSSLNTLCLKNCKKLKYVEELPLSLNHLYAHGCDYLENVTLSPNHTIKHLDLRDCPRLKQSEQIKTLVSNERHG

Gene3D: G3DSA:3.80.10.10
535-645 G3DSA:3.80.10.10

SDVSSITHGLKLLHWDAYPLETLPFSFQSSTLVEINLRYSNLKHFWDETKVYRSKQLPNLRRLDVTGSTSLVELPDLSDSMNLEELIMEGCRSLRQTPWSLNRLPLRKLNM

HMMPfam: PF07725
IPR011713
566-584 LRR_3
Leucine-rich repeat 3

LVEINLRYSNLKHFWDETK

Gene3D: G3DSA:3.80.10.10
763-954 G3DSA:3.80.10.10

SFSSFPCLTELKLINLSIREIPQDIDCLLSLRKMDLTGNDFVHLPKTMAQLTKLECLTLRNCRQLKALPLLTPTLTLPGLDNQPRGLIELCIDNCKNLQSLQDQLLCYNTSLAYLDLSNHDFERIPTSIRHLSSLNTLCLKNCKKLKYVEELPLSLNHLYAHGCDYLENVTLSPNHTIKHLDLRDCPRLKQS

FPrintScan: PR00364
IPR000767
892-908 DISEASERSIST
Disease resistance protein

RHLSSLNTLCLKNCKKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox