PRGDB00047075 (disease resistance protein (NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18413218 (NM_117004)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (NBS-LRR class), putative (AT4G09360) mRNA, complete cds.

DNA Sequence

ATGGACGTTGACATGGAACGACTGAATCCTCTATTGAGCATCGAATCTGAGAATGAGGTTCGTATGATCGGAATCTGGGGAATGGGAGGCATAGGCAAAACCACCATTGCCAAGTGTCTCTATGAAGAATATTCGCGCCGATTTGTTCACTATTGTTTCATAGAAAACGTTAGGATTTTTGCAAAGAATGGCCTCCCATATTTGCAGGAAAAGCTTCTATCTGAAATCCGAGGCAAAAAGCAAGAGACCTTATGGAGCGTGGAGAAGGGATGCAGACTTATCAAGTCGAAGCTCAAGGAAAAAAATTTCCTTGTCCTTGACGATGTGGACAATGTGGACCAGCTGCATGCCCTAGCAAAAGAGACGAGCTGGTTTGGACCAGGGAGCCGAATCATCATAACTACACGAGACTTTGGCTTACTCTACTCCTTTGGAGTGAGATTATTATACCGTGTTAGCTTTTTGGATGACAATGATGCTATCAAAGTCTTTAAACATGTTGCTTTTGACGGAGGGCAACCTCCTTTTGATGTCTACCATCAATTCTCAGTCCGTGCTTCTAGGCTTGCTCAAGGCCTTCCTTCAGCCCTTGAGGCTTTTGGCGCGTTGGGCATTCTTGAAACAGTTCCTCAAAAACGTATCAAGGATATTTTAAAAACTAGCTATGACGGTTTAGACGAGGAAGAGCAAGCTGCGTTCCTTCATGTTGCATGTCTATTCAATGGAGACTCTGTCCACCGGGTAAATGCCCTTATCGATGATGGTGACATGAGGATAAAAGCTTTAGAAGTGAAGTCTCTCATAGACATATCACTTGATGGATGCATTACATTGCATGTCTTGATAGAACAAGCGGCAAGAGAAATTGATACAGCAATGGTTGAAGGTGTAGCACTTCACATGTGTGAGATGATACACGTGTTGCCTATCGACGGAAATATTCTTAACACTATCAACAATCTCAAATTCTTCAAGGCTTTCACGCATATAGAGGTTATGAATTCCAAATTGCAGTTTCTTCCAGGCACAGCTAACAATTCAGGGGGCCTTGGTCAGTTGAGGAGACTAGATGTTACTGGCTCTAAGAATCTGAGAGAAATTCCAGATCTCTCGAGGACCATGCTGCTCGAGGAGTTGATAATGAAAGGCTGCACAAGATTGGAGAAAACTCTAGATATCAGAAAAGGCTGTCCTTCCAGAACGTGGACTAAGGCGACGCCGACAAATAATATTGAGGCTTCCCAGAGGAGTAAAGAAGCTGAGTTCTCTTGCAAACCTATCTATAGAAGGGAAGATACACATCGGCTTGTGGCATCTCACGGGAACCGTAGAGCACCTCTCCTTTATTCCGAGCAAAAAATCCCTGATGAATTGGTAATGGTGCCAAAGAAAAGATTTCCGATCATCTCAAGCTTTTATGATCTTAAATCTCTCAGCATCATGCGGTTTAGCCACATTGCAGATGGTACCCCCTTCCGTTGCATTAGCTTCTCAGGTTTCCAGTGCTTGGTAGAGTTGAATCTGATCAACTTAAACATCCAGAAAATCCCAGACAACATTGGTCTAATGCAGTCACTAGAGAAAGTGGACCTCAGCGGAAATGATTTCAGGAATCTACCCGCATCAACAAAGAACCTTTCGAAGTTGAAATACGCGAGGCTCTCTAATTGCATCAAACTCGAGGCATTTGTAGAGCTGACTGAGTTGCAGACGCTCAAGCTTTCTGGTTGTACGAACCTCGAATCTCTGCTGGAACTTCCTTATGCGGTTCAAGATGTAGGCAGATTCTGTTTGCTAGCGCTTGAGCTTGATAACTGCAAGAATCTCCAAGCATTATCAGAACAGCTAAGCCATTTCAGCAATTTAATACACTTGGACCTAAGCAGCCACGACTTTGAGAAACTCAAATCAGTGGAAGAGCTTCCACTAAACCTCAAGCATCTCTACGCACACGGCTGTGATTCCCTGGAAAGTGTCGACCTTTCCCCAAAGCATTCAATCAAACACCTCGATCTTAGCCATTGCTTCGGTTTGCAACAAGATGAGCAACAGATTACACAATTTCTAAACGACAAGTGTAGCCAAGAGGTTTCACAAAGATTTCTTTGCTTACCAGGAACTGAAGTACCCAGAAATTTCGATAATCAGTCACATGGGACATCGACGAAGATCAGCTTGTTTACACCGACACTTCTGAGTTTCGCTGCCTGTATCTTGATTTCTTGCGAGAGGTCCTTCTACCTCCAATTCCCAGCGTTTAGTTATGATTGGAACCGCAAAGATGATGAAGTAATTTCGATTAACCTCACACCAAATCTCAATCTTTCATCGGAGATTGAGGAAGAAGAGACTGTAACATCACATCACCTGGTTATCATCCACGTACCCAGTAGCATAAACACCGACAAAATCGAAGATTTGCGACTCGAATCCTCTCTTCAATTTCCAGAGGAGTTTCAGTTTTCACCCTGCGAGATAAGAGCTTGTGGAATTCGCATGGTTGACGAAGAGACTAAATGTCTGGAGAGCTCACCTCTTATGCCACTATTGGAGAAGAAATAA


Protein sequences

Name Description Sequence
disease resistance protein (NBS-LRR class), putative disease resistance protein (NBS-LRR class), putative [Arabidopsis thaliana].

MDVDMERLNPLLSIESENEVRMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGVRLLYRVSFLDDNDAIKVFKHVAFDGGQPPFDVYHQFSVRASRLAQGLPSALEAFGALGILETVPQKRIKDILKTSYDGLDEEEQAAFLHVACLFNGDSVHRVNALIDDGDMRIKALEVKSLIDISLDGCITLHVLIEQAAREIDTAMVEGVALHMCEMIHVLPIDGNILNTINNLKFFKAFTHIEVMNSKLQFLPGTANNSGGLGQLRRLDVTGSKNLREIPDLSRTMLLEELIMKGCTRLEKTLDIRKGCPSRTWTKATPTNNIEASQRSKEAEFSCKPIYRREDTHRLVASHGNRRAPLLYSEQKIPDELVMVPKKRFPIISSFYDLKSLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFEKLKSVEELPLNLKHLYAHGCDSLESVDLSPKHSIKHLDLSHCFGLQQDEQQITQFLNDKCSQEVSQRFLCLPGTEVPRNFDNQSHGTSTKISLFTPTLLSFAACILISCERSFYLQFPAFSYDWNRKDDEVISINLTPNLNLSSEIEEEETVTSHHLVIIHVPSSINTDKIEDLRLESSLQFPEEFQFSPCEIRACGIRMVDEETKCLESSPLMPLLEKK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-811 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MDVDMERLNPLLSIESENEVRMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGVRLLYRVSFLDDNDAIKVFKHVAFDGGQPPFDVYHQFSVRASRLAQGLPSALEAFGALGILETVPQKRIKDILKTSYDGLDEEEQAAFLHVACLFNGDSVHRVNALIDDGDMRIKALEVKSLIDISLDGCITLHVLIEQAAREIDTAMVEGVALHMCEMIHVLPIDGNILNTINNLKFFKAFTHIEVMNSKLQFLPGTANNSGGLGQLRRLDVTGSKNLREIPDLSRTMLLEELIMKGCTRLEKTLDIRKGCPSRTWTKATPTNNIEASQRSKEAEFSCKPIYRREDTHRLVASHGNRRAPLLYSEQKIPDELVMVPKKRFPIISSFYDLKSLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFEKLKSVEELPLNLKHLYAHGCDSLESVDLSPKHSIKHLDLSHCFGLQQDEQQITQFLNDKCSQEVSQRFLCLPGTEVPRNFDNQSHGTSTKISLFTPTLLSFAACILISCERSFYLQFPAFSYDWNRKDDEVISINLTPNLNLSSEIEEEETVTSHHLVIIHVPSSINTDKIEDLRLES

HMMPanther: PTHR23155:SF345
1-811 PTHR23155:SF345

MDVDMERLNPLLSIESENEVRMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGVRLLYRVSFLDDNDAIKVFKHVAFDGGQPPFDVYHQFSVRASRLAQGLPSALEAFGALGILETVPQKRIKDILKTSYDGLDEEEQAAFLHVACLFNGDSVHRVNALIDDGDMRIKALEVKSLIDISLDGCITLHVLIEQAAREIDTAMVEGVALHMCEMIHVLPIDGNILNTINNLKFFKAFTHIEVMNSKLQFLPGTANNSGGLGQLRRLDVTGSKNLREIPDLSRTMLLEELIMKGCTRLEKTLDIRKGCPSRTWTKATPTNNIEASQRSKEAEFSCKPIYRREDTHRLVASHGNRRAPLLYSEQKIPDELVMVPKKRFPIISSFYDLKSLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFEKLKSVEELPLNLKHLYAHGCDSLESVDLSPKHSIKHLDLSHCFGLQQDEQQITQFLNDKCSQEVSQRFLCLPGTEVPRNFDNQSHGTSTKISLFTPTLLSFAACILISCERSFYLQFPAFSYDWNRKDDEVISINLTPNLNLSSEIEEEETVTSHHLVIIHVPSSINTDKIEDLRLES

HMMPfam: PF00931
IPR002182
5-203 NB-ARC,NBS
NB-ARC

MERLNPLLSIESENEVRMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGVRLLYRVSFLDDNDAIKVFKHVAFDGGQPPFDVYHQFSVRASRLAQGLPSALEAFGAL

superfamily: SSF52540
18-206 SSF52540

NEVRMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGVRLLYRVSFLDDNDAIKVFKHVAFDGGQPPFDVYHQFSVRASRLAQGLPSALEAFGALGIL

HMMSmart: SM00382
IPR003593
19-154 AAA,NBS
AAA+ ATPase domain

EVRMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGVRLLYRVSF

Gene3D: G3DSA:3.40.50.300
21-146 G3DSA:3.40.50.300

RMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGV

FPrintScan: PR00364
IPR000767
22-37 DISEASERSIST
Disease resistance protein

MIGIWGMGGIGKTTIA

FPrintScan: PR00364
IPR000767
96-110 DISEASERSIST
Disease resistance protein

SKLKEKNFLVLDDVD

FPrintScan: PR00364
IPR000767
190-204 DISEASERSIST
Disease resistance protein

AQGLPSALEAFGALG

superfamily: SSF52058
258-700 SSF52058,LRR

RIKALEVKSLIDISLDGCITLHVLIEQAAREIDTAMVEGVALHMCEMIHVLPIDGNILNTINNLKFFKAFTHIEVMNSKLQFLPGTANNSGGLGQLRRLDVTGSKNLREIPDLSRTMLLEELIMKGCTRLEKTLDIRKGCPSRTWTKATPTNNIEASQRSKEAEFSCKPIYRREDTHRLVASHGNRRAPLLYSEQKIPDELVMVPKKRFPIISSFYDLKSLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFEKLKSVEELPLNLKHLYAHGCDSLESVDLSPKHSIKHLDLSHCFGLQQDEQQITQFLNDKCSQEVSQR

Gene3D: G3DSA:3.80.10.10
302-398 G3DSA:3.80.10.10

CEMIHVLPIDGNILNTINNLKFFKAFTHIEVMNSKLQFLPGTANNSGGLGQLRRLDVTGSKNLREIPDLSRTMLLEELIMKGCTRLEKTLDIRKGCP

Gene3D: G3DSA:3.80.10.10
470-675 G3DSA:3.80.10.10

SSFYDLKSLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFEKLKSVEELPLNLKHLYAHGCDSLESVDLSPKHSIKHLDLSHC

HMMPfam: PF00560
IPR001611
525-546 LRR_1
Leucine-rich repeat

SLEKVDLSGNDFRNLPASTKNL

FPrintScan: PR00364
IPR000767
564-580 DISEASERSIST
Disease resistance protein

VELTELQTLKLSGCTNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox