PRGDB00047076 (disease resistance protein, putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18400872 (NM_112440)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein, putative (AT3G15700) mRNA, complete cds.

DNA Sequence

ATGGGGAAAGATTTCAAGAGTATGGTGACACGATGCATCTACGTCGGAAAAGAGAACGATAACGTGAAGAAGCTGAAAACCGCTACAGAGGAGCTCAAAGATTTACGCAACATTGTGATGAAAAGGGTCAAAATGTATGAAGACCAACAGAAGCTGAAGCGGCTCGAGAAAGTCCAAGTCTGGCTTAGACAAGCCGATGTAGCGATCAAAGAAGCAGAAGAAATGTTGATAACGTTGATGTCTTCCTCTTCTTCTAATGGATCGAGCATGATGAGTTTTCACAAGCTGGACAAGAAGCTTTGCAAGAAGCTGAAAGAGGTTCAGGAGATAAAGAGCAGAGGAACATTCGATGTGGTGGTTGAGAATAGTGGCATTGGTAGTGGATCGATGATGATTTCGAATGTTGATAGAGATGATCAGACGGTTGGGTTGGAGGCGGTTTCCGGGCTAGTGTGGAGGTGTATGACGGTGGATAACACCGGGATTATTGGGTTGTACGGCGTGGAAGGTGTTGGGAAGACGACGGTGTTGACTCAGGTAAACAACAGGTTGCTTCAGCACAAGTTAAATGGGTTTGACTTTGTGATTTGGGTGTTTGTGTCCAAGAATGTGAATCTTGAAAAGATTCAGGACACGATCCGAGAGAAGATAGGGTTTCTTGATAGGTCGTGGATGAGCAAGACAGAGGAAGAGAAAGCCGGTAAGATCTTCGAGATACTTAGCAAGAGACGATTCGCTTTATTCCTCGATGACGTTTGGGAGAAAGTCGATCTAGTGAAAGCTGGTGTGCCGCCTCCGGATGGACTGAACAGGTCTAAGATCGTGTTCACAACCTGTTCGGACGAGGTTTGTCAAGAAATGGGAGCACAAACTAAGATCAAAATGGAGAAGCTGCCATGGGAGAGAGCTTGGGACTTGTTTAAGATGAATGCTGGAGAAGAGATAGTGAAGAGCCACCCGGACATAACCAAAGTTGCTCAAGAGGTTGCAGCCAAGTGTGATGGCCTCCCGCTGGCTCTGGTCACAATTGGCCGAGCCATGGCCTCTAAGAAAACACCTCAGGAATGGCGTGACGCTTTGTACATCTTGAGTACCTCTCCTCCTAATTTCTCAGGTCCAATTCTATAA


Protein sequences

Name Description Sequence
disease resistance protein, putative disease resistance protein, putative [Arabidopsis thaliana].

MGKDFKSMVTRCIYVGKENDNVKKLKTATEELKDLRNIVMKRVKMYEDQQKLKRLEKVQVWLRQADVAIKEAEEMLITLMSSSSSNGSSMMSFHKLDKKLCKKLKEVQEIKSRGTFDVVVENSGIGSGSMMISNVDRDDQTVGLEAVSGLVWRCMTVDNTGIIGLYGVEGVGKTTVLTQVNNRLLQHKLNGFDFVIWVFVSKNVNLEKIQDTIREKIGFLDRSWMSKTEEEKAGKIFEILSKRRFALFLDDVWEKVDLVKAGVPPPDGLNRSKIVFTTCSDEVCQEMGAQTKIKMEKLPWERAWDLFKMNAGEEIVKSHPDITKVAQEVAAKCDGLPLALVTIGRAMASKKTPQEWRDALYILSTSPPNFSGPIL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
25-267 PTHR23155:SF108,SUBFAMILY NOT NAMED

LKTATEELKDLRNIVMKRVKMYEDQQKLKRLEKVQVWLRQADVAIKEAEEMLITLMSSSSSNGSSMMSFHKLDKKLCKKLKEVQEIKSRGTFDVVVENSGIGSGSMMISNVDRDDQTVGLEAVSGLVWRCMTVDNTGIIGLYGVEGVGKTTVLTQVNNRLLQHKLNGFDFVIWVFVSKNVNLEKIQDTIREKIGFLDRSWMSKTEEEKAGKIFEILSKRRFALFLDDVWEKVDLVKAGVPPPD

HMMPanther: PTHR23155
25-267 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LKTATEELKDLRNIVMKRVKMYEDQQKLKRLEKVQVWLRQADVAIKEAEEMLITLMSSSSSNGSSMMSFHKLDKKLCKKLKEVQEIKSRGTFDVVVENSGIGSGSMMISNVDRDDQTVGLEAVSGLVWRCMTVDNTGIIGLYGVEGVGKTTVLTQVNNRLLQHKLNGFDFVIWVFVSKNVNLEKIQDTIREKIGFLDRSWMSKTEEEKAGKIFEILSKRRFALFLDDVWEKVDLVKAGVPPPD

superfamily: SSF52540
124-357 SSF52540

GIGSGSMMISNVDRDDQTVGLEAVSGLVWRCMTVDNTGIIGLYGVEGVGKTTVLTQVNNRLLQHKLNGFDFVIWVFVSKNVNLEKIQDTIREKIGFLDRSWMSKTEEEKAGKIFEILSKRRFALFLDDVWEKVDLVKAGVPPPDGLNRSKIVFTTCSDEVCQEMGAQTKIKMEKLPWERAWDLFKMNAGEEIVKSHPDITKVAQEVAAKCDGLPLALVTIGRAMASKKTPQEWR

HMMPfam: PF00931
IPR002182
158-366 NB-ARC,NBS
NB-ARC

DNTGIIGLYGVEGVGKTTVLTQVNNRLLQHKLNGFDFVIWVFVSKNVNLEKIQDTIREKIGFLDRSWMSKTEEEKAGKIFEILSKRRFALFLDDVWEKVDLVKAGVPPPDGLNRSKIVFTTCSDEVCQEMGAQTKIKMEKLPWERAWDLFKMNAGEEIVKSHPDITKVAQEVAAKCDGLPLALVTIGRAMASKKTPQEWRDALYILSTS

Gene3D: G3DSA:3.40.50.300
161-252 G3DSA:3.40.50.300

GIIGLYGVEGVGKTTVLTQVNNRLLQHKLNGFDFVIWVFVSKNVNLEKIQDTIREKIGFLDRSWMSKTEEEKAGKIFEILSKRRFALFLDDV

FPrintScan: PR00364
IPR000767
162-177 DISEASERSIST
Disease resistance protein

IIGLYGVEGVGKTTVL

FPrintScan: PR00364
IPR000767
239-253 DISEASERSIST
Disease resistance protein

ILSKRRFALFLDDVW

FPrintScan: PR00364
IPR000767
333-347 DISEASERSIST
Disease resistance protein

CDGLPLALVTIGRAM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox