PRGDB00047077 (disease resistance protein (NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18400401 (NM_112306)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (NBS-LRR class), putative (AT3G14460) mRNA, complete cds.

DNA Sequence

ATGGCGAACTCCTATTTATCAAGTTGTGCAAACGTGATGGTTGAACGGATTAATACTTCTCAAGAATTGGTCGAACTATGTAAAGGAAAGTCCTCCAGTGCATTGCTGAAGAGATTGAAGGTTGCTTTGGTGACTGCAAACCCGGTGCTTGCGGATGCTGATCAGAGAGCAGAACATGTTCGGGAAGTTAAACATTGGCTTACAGGAATCAAAGATGCTTTCTTCCAGGCAGAGGATATCCTTGATGAGTTGCAAACAGAAGCTTTGAGAAGAAGAGTAGTAGCTGAAGCAGGAGGCTTAGGAGGACTATTCCAGAATCTCATGGCTGGTCGAGAAGCCATTCAGAAAAAGATAGAACCAAAGATGGAAAAAGTAGTTAGACTACTGGAACATCATGTGAAACACATTGAAGTTATTGGATTGAAAGAATATAGCGAGACTCGAGAACCACAATGGAGGCAAGCATCACGGTCAAGACCTGATGATCTTCCACAAGGCAGATTGGTCGGGCGAGTGGAAGATAAGCTAGCGTTAGTCAATTTGCTGCTTTCTGATGATGAAATAAGCATTGGGAAACCAGCTGTTATCTCCGTAGTTGGTATGCCAGGGGTTGGAAAGACTACCTTGACAGAGATAGTTTTTAATGACTACAGGGTGACCGAACATTTTGAGGTTAAAATGTGGATCTCTGCTGGGATAAACTTTAATGTCTTTACGGTTACAAAAGCAGTTCTGCAGGATATCACTTCAAGTGCAGTTAATACTGAGGATCTACCTTCACTTCAAATTCAGCTGAAGAAAACACTCTCGGGGAAGAGATTTTTACTTGTTCTGGATGATTTTTGGTCTGAAAGTGATTCAGAATGGGAGAGTTTCCAGGTCGCCTTTACTGATGCAGAGGAAGGAAGCAAGATTGTTCTAACCACACGAAGTGAAATTGTCTCCACAGTAGCAAAGGCTGAAAAAATCTACCAAATGAAGTTGATGACTAATGAAGAATGTTGGGAGCTGATCTCTAGATTCGCTTTTGGAAATATATCAGTCGGTTCTATCAACCAAGAACTAGAAGGAATTGGCAAAAGGATTGCAGAACAGTGCAAGGGCTTGCCATTAGCTGCACGAGCCATTGCATCTCATCTCCGTTCAAAGCCAAATCCTGACGACTGGTATGCTGTATCAAAGAATTTTTCAAGCTACACCAACAGTATCCTTCCAGTTCTTAAACTAAGCTATGACTCTCTTCCTCCTCAACTTAAGCGATGCTTTGCCCTCTGCTCGATATTCCCCAAGGGTCATGTTTTCGATAGGGAGGAATTAGTACTCCTATGGATGGCAATAGACCTCTTATACCAACCAAGGAGCAGCAGAAGATTGGAAGATATTGGAAATGATTACCTTGGTGATTTAGTTGCTCAATCTTTTTTTCAGAGATTGGATATCACCATGACGAGCTTTGTGATGCATGATCTTATGAATGATTTGGCAAAAGCTGTTTCAGGAGATTTTTGTTTCAGACTGGAAGATGACAACATTCCGGAGATACCAAGCACAACTCGACATTTTTCATTTTCTAGAAGCCAATGTGATGCTTCTGTGGCTTTTAGGTCCATCTGTGGAGCTGAGTTTCTGAGAACCATTCTTCCTTTCAACTCGCCAACAAGTCTTGAATCTCTCCAACTAACAGAAAAAGTTTTGAATCCTTTGCTCAATGCATTGAGTGGCCTACGAATTCTTAGCTTGTCTCATTATCAGATAACCAACTTGCCTAAATCGTTAAAAGGTTTGAAGCTTTTACGGTATCTAGATCTGTCAAGCACCAAAATAAAAGAGCTCCCAGAGTTTGTGTGTACTCTCTGTAATCTGCAGACACTATTGTTGTCAAATTGTCGTGACCTCACAAGCCTGCCAAAAAGCATTGCCGAACTTATCAATTTGCGCCTCCTTGACCTCGTTGGCACTCCTTTAGTAGAGATGCCACCCGGAATAAAAAAGCTGCGAAGCTTGCAGAAGTTATCAAATTTTGTTATAGGAAGGCTGAGTGGTGCCGGGCTGCATGAGCTCAAAGAACTTTCTCATCTCCGAGGGACACTTCGCATCTCTGAGCTACAAAATGTGGCGTTTGCCTCAGAAGCAAAAGATGCTGGTTTGAAAAGAAAGCCATTCCTTGACGGGTTAATCCTGAAGTGGACTGTCAAAGGTTCTGGCTTCGTCCCTGGTAGTTTTAATGCATTGGCATGTGACCAGAAAGAGGTCCTAAGGATGCTAGAACCCCATCCACACTTGAAAACGTTCTGCATTGAATCTTATCAGGGTGGAGCATTTCCTAAGTGGTTGGGTGATTCTTCATTCTTCGGTATTACGTCCGTCACTCTCAGTAGCTGCAACCTCTGCATATCACTGCCTCCAGTGGGGCAGTTGCCTTCACTCAAGTATCTCAGCATTGAAAAATTTAATATTCTGCAGAAGGTTGGTCTAGACTTCTTCTTCGGTGAGAACAACTCTAGAGGTGTACCGTTTCAATCCTTGCAAATTCTAAAGTTCTATGGCATGCCAAGATGGGACGAATGGATTTGTCCGGAACTAGAAGATGGGATCTTTCCTTGCCTCCAAAAACTCATAATACAAAGATGCCCCAGCTTAAGAAAAAAGTTTCCAGAAGGACTCCCTTCATCCACTGAAGTCACCATCTCTGATTGTCCCCTAAGAGCAGTTTCTGGAGGAGAAAATTCCTTCAGAAGGAGTCTGACAAATATTCCAGAAAGTCCAGCCAGCATTCCCTCTATGAGCAGAAGGGAACTGTCTTCCCCTACAGGGAATCCAAAATCAGATGCAAGTACCAGTGCTCAGCCAGGTTTTGCTTCAAGTAGTCAAAGTAATGATGACAATGAAGTAACTTCAACATCAAGCTTGTCATCTTTACCAAAGGACCGTCAAACAGAAGATTTCGACCAATATGAAACTCAACTTGGAAGCTTACCACAACAATTTGAAGAACCTGCTGTGATCTCGGCAAGATACTCAGGATATATCTCGGATATACCTAGCACGTTAAGTCCGTATATGTCAAGAACATCACTTGTTCCAGATCCCAAAAATGAAGGTTCTATTCTTCCTGGAAGTAGTAGCTACCAGTACCATCAATATGGGATTAAGTCATCTGTTCCGAGTCCACGGTCAAGTGAAGCAATAAAGCCGTCACAATATGATGATGATGAAACAGACATGGAATATTTAAAAGTGACAGACATATCTCACCTCATGGAGCTTCCTCAGAATCTGCAGTCACTCCACATCGACAGCTGCGACGGACTCACTTCCTTACCGGAGAACTTAACAGAAAGCTATCCAAACCTCCATGAACTACTCATCATTGCTTGTCATTCTCTAGAATCTTTCCCTGGAAGCCACCCTCCAACCACATTGAAAACCTTATACATAAGAGACTGCAAGAAACTAAATTTCACAGAGAGTTTGCAACCAACACGAAGTTACTCACAGCTCGAGTACCTTTTCATCGGAAGTAGCTGCAGCAATCTCGTCAATTTCCCTCTATCATTGTTTCCGAAGCTGAGAAGCCTCTCAATTAGGGATTGTGAAAGCTTCAAAACTTTCTCGATTCACGCAGGACTCGGAGACGATCGTATCGCACTCGAGTCTCTTGAGATTAGGGATTGCCCAAATCTGGAAACTTTCCCACAAGGAGGCCTTCCAACACCGAAACTTTCTTCAATGTTACTCTCAAACTGCAAAAAGCTTCAAGCTTTACCTGAGAAATTGTTTGGACTCACTTCTCTCTTGTCACTGTTTATAATCAAATGCCCAGAAATCGAGACGATTCCTGGTGGAGGGTTCCCAAGTAATCTTCGAACACTTTGCATCAGCCTTTGCGACAAGCTTACACCGAGAATCGAATGGGGATTGAGAGATTTGGAGAATCTTCGAAATCTCGAGATTGATGGAGGAAACGAAGACATTGAATCGTTTCCTGAGGAAGGGTTATTGCCAAAAAGTGTTTTTTCTCTGCGGATTAGTCGTTTCGAGAACCTCAAGACTCTGAATCGAAAAGGGTTTCATGATACAAAAGCTATTGAGACGATGGAGATCAGCGGCTGTGATAAGCTACAGATATCGATAGATGAAGATCTTCCTCCTTTGTCTTGTCTGAGAATAAGCTCATGTTCTTTGTTGACTGAGACTTTTGCTGAAGTGGAAACAGAGTTCTTCAAGGTTTTGAACATTCCATACGTGGAAATCGATGGCGAGATCTTCTCTTGA


Protein sequences

Name Description Sequence
disease resistance protein (NBS-LRR class), putative disease resistance protein (NBS-LRR class), putative [Arabidopsis thaliana].

MANSYLSSCANVMVERINTSQELVELCKGKSSSALLKRLKVALVTANPVLADADQRAEHVREVKHWLTGIKDAFFQAEDILDELQTEALRRRVVAEAGGLGGLFQNLMAGREAIQKKIEPKMEKVVRLLEHHVKHIEVIGLKEYSETREPQWRQASRSRPDDLPQGRLVGRVEDKLALVNLLLSDDEISIGKPAVISVVGMPGVGKTTLTEIVFNDYRVTEHFEVKMWISAGINFNVFTVTKAVLQDITSSAVNTEDLPSLQIQLKKTLSGKRFLLVLDDFWSESDSEWESFQVAFTDAEEGSKIVLTTRSEIVSTVAKAEKIYQMKLMTNEECWELISRFAFGNISVGSINQELEGIGKRIAEQCKGLPLAARAIASHLRSKPNPDDWYAVSKNFSSYTNSILPVLKLSYDSLPPQLKRCFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQRLDITMTSFVMHDLMNDLAKAVSGDFCFRLEDDNIPEIPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWICPELEDGIFPCLQKLIIQRCPSLRKKFPEGLPSSTEVTISDCPLRAVSGGENSFRRSLTNIPESPASIPSMSRRELSSPTGNPKSDASTSAQPGFASSSQSNDDNEVTSTSSLSSLPKDRQTEDFDQYETQLGSLPQQFEEPAVISARYSGYISDIPSTLSPYMSRTSLVPDPKNEGSILPGSSSYQYHQYGIKSSVPSPRSSEAIKPSQYDDDETDMEYLKVTDISHLMELPQNLQSLHIDSCDGLTSLPENLTESYPNLHELLIIACHSLESFPGSHPPTTLKTLYIRDCKKLNFTESLQPTRSYSQLEYLFIGSSCSNLVNFPLSLFPKLRSLSIRDCESFKTFSIHAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCISLCDKLTPRIEWGLRDLENLRNLEIDGGNEDIESFPEEGLLPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDKLQISIDEDLPPLSCLRISSCSLLTETFAEVETEFFKVLNIPYVEIDGEIFS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF235
4-938 PTHR23155:SF235,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

SYLSSCANVMVERINTSQELVELCKGKSSSALLKRLKVALVTANPVLADADQRAEHVREVKHWLTGIKDAFFQAEDILDELQTEALRRRVVAEAGGLGGLFQNLMAGREAIQKKIEPKMEKVVRLLEHHVKHIEVIGLKEYSETREPQWRQASRSRPDDLPQGRLVGRVEDKLALVNLLLSDDEISIGKPAVISVVGMPGVGKTTLTEIVFNDYRVTEHFEVKMWISAGINFNVFTVTKAVLQDITSSAVNTEDLPSLQIQLKKTLSGKRFLLVLDDFWSESDSEWESFQVAFTDAEEGSKIVLTTRSEIVSTVAKAEKIYQMKLMTNEECWELISRFAFGNISVGSINQELEGIGKRIAEQCKGLPLAARAIASHLRSKPNPDDWYAVSKNFSSYTNSILPVLKLSYDSLPPQLKRCFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQRLDITMTSFVMHDLMNDLAKAVSGDFCFRLEDDNIPEIPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWICPELEDGIFPCLQKLIIQRCPSLRKKFPEGLPSSTEVTISDCPLRAVSGGENSFRRSLTNIPESPASIPSMSRRELSSPTG

HMMPanther: PTHR23155
4-938 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SYLSSCANVMVERINTSQELVELCKGKSSSALLKRLKVALVTANPVLADADQRAEHVREVKHWLTGIKDAFFQAEDILDELQTEALRRRVVAEAGGLGGLFQNLMAGREAIQKKIEPKMEKVVRLLEHHVKHIEVIGLKEYSETREPQWRQASRSRPDDLPQGRLVGRVEDKLALVNLLLSDDEISIGKPAVISVVGMPGVGKTTLTEIVFNDYRVTEHFEVKMWISAGINFNVFTVTKAVLQDITSSAVNTEDLPSLQIQLKKTLSGKRFLLVLDDFWSESDSEWESFQVAFTDAEEGSKIVLTTRSEIVSTVAKAEKIYQMKLMTNEECWELISRFAFGNISVGSINQELEGIGKRIAEQCKGLPLAARAIASHLRSKPNPDDWYAVSKNFSSYTNSILPVLKLSYDSLPPQLKRCFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQRLDITMTSFVMHDLMNDLAKAVSGDFCFRLEDDNIPEIPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWICPELEDGIFPCLQKLIIQRCPSLRKKFPEGLPSSTEVTISDCPLRAVSGGENSFRRSLTNIPESPASIPSMSRRELSSPTG

superfamily: SSF52540
150-395 SSF52540

PQWRQASRSRPDDLPQGRLVGRVEDKLALVNLLLSDDEISIGKPAVISVVGMPGVGKTTLTEIVFNDYRVTEHFEVKMWISAGINFNVFTVTKAVLQDITSSAVNTEDLPSLQIQLKKTLSGKRFLLVLDDFWSESDSEWESFQVAFTDAEEGSKIVLTTRSEIVSTVAKAEKIYQMKLMTNEECWELISRFAFGNISVGSINQELEGIGKRIAEQCKGLPLAARAIASHLRSKPNPDDWYAVSKN

HMMPfam: PF00931
IPR002182
186-446 NB-ARC,NBS
NB-ARC

DEISIGKPAVISVVGMPGVGKTTLTEIVFNDYRVTEHFEVKMWISAGINFNVFTVTKAVLQDITSSAVNTEDLPSLQIQLKKTLSGKRFLLVLDDFWSESDSEWESFQVAFTDAEEGSKIVLTTRSEIVSTVAKAEKIYQMKLMTNEECWELISRFAFGNISVGSINQELEGIGKRIAEQCKGLPLAARAIASHLRSKPNPDDWYAVSKNFSSYTNSILPVLKLSYDSLPPQLKRCFALCSIFPKGHVFDREELVLLWMAI

Gene3D: G3DSA:3.40.50.300
191-315 G3DSA:3.40.50.300

GKPAVISVVGMPGVGKTTLTEIVFNDYRVTEHFEVKMWISAGINFNVFTVTKAVLQDITSSAVNTEDLPSLQIQLKKTLSGKRFLLVLDDFWSESDSEWESFQVAFTDAEEGSKIVLTTRSEIVS

FPrintScan: PR00364
IPR000767
195-210 DISEASERSIST
Disease resistance protein

VISVVGMPGVGKTTLT

FPrintScan: PR00364
IPR000767
268-282 DISEASERSIST
Disease resistance protein

TLSGKRFLLVLDDFW

FPrintScan: PR00364
IPR000767
366-380 DISEASERSIST
Disease resistance protein

CKGLPLAARAIASHL

superfamily: SSF52058
486-902 SSF52058,LRR

VMHDLMNDLAKAVSGDFCFRLEDDNIPEIPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWICPELEDGIFPCLQKLIIQRCPSLRKKFPEGLPSSTEVTISDCPLR

Gene3D: G3DSA:3.80.10.10
547-685 G3DSA:3.80.10.10

LPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLVEMPPGIKKLRSLQKLSNFVIGRLSGAGLH

HMMPfam: PF12799
575-613 LRR_4,Leucine Rich repeats (2 copies)

LRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPE

FPrintScan: PR00364
IPR000767
616-632 DISEASERSIST
Disease resistance protein

CTLCNLQTLLLSNCRDL

HMMPfam: PF00560
IPR001611
620-641 LRR_1
Leucine-rich repeat

NLQTLLLSNCRDLTSLPKSIAE

Gene3D: G3DSA:3.80.10.10
749-832 G3DSA:3.80.10.10

KEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGEN

Gene3D: G3DSA:3.80.10.10
869-901 G3DSA:3.80.10.10

LQKLIIQRCPSLRKKFPEGLPSSTEVTISDCPL

superfamily: SSF52058
1063-1412 SSF52058,LRR

IKPSQYDDDETDMEYLKVTDISHLMELPQNLQSLHIDSCDGLTSLPENLTESYPNLHELLIIACHSLESFPGSHPPTTLKTLYIRDCKKLNFTESLQPTRSYSQLEYLFIGSSCSNLVNFPLSLFPKLRSLSIRDCESFKTFSIHAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCISLCDKLTPRIEWGLRDLENLRNLEIDGGNEDIESFPEEGLLPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDKLQISIDEDLPPLSCLRISSCSLLTETFAEVETEFFKVLN

Gene3D: G3DSA:3.80.10.10
1072-1398 G3DSA:3.80.10.10

ETDMEYLKVTDISHLMELPQNLQSLHIDSCDGLTSLPENLTESYPNLHELLIIACHSLESFPGSHPPTTLKTLYIRDCKKLNFTESLQPTRSYSQLEYLFIGSSCSNLVNFPLSLFPKLRSLSIRDCESFKTFSIHAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCISLCDKLTPRIEWGLRDLENLRNLEIDGGNEDIESFPEEGLLPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDKLQISIDEDLPPLSCLRISSCSLLTE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox