PRGDB00047079 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18398239 (NM_127240)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT2G16870) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCTTCATCGTCTCGCACCTGGAATTACCGAGTCTTTGCGAGCTTCCACGGACCAGACGTCCGTAAAAGCTTTCTGAGTCATTTTCGCAAACAGTTCATCTGCAATGGGATTACAATGTTCGATGATCAAAAGATCGTGAGAAGTCAAACCATCGCTCCTTCACTCACGCAAGGGATTAGAGAATCGAAGATCTCGATCGTCATTCTCTCCAAGAACTATGCTTCTTCTACTTGGTGTTTGAATGAGCTCCTGGAGATTTTGAAGTGCAGGGAAGATATTGGGCAAATTGTGATGACTGTATTCTACGGAGTAGATCCATCTGATGTCCGCAAACAAACCGGTGAATTTGGAACAGTTTTCAATAAAACTTGTGCTCGTAGAACAGAGAAAGAGAGGCGAAATTGGAGCCAAGCTTTGAATGTTGTGGGAAACATAGCCGGAGAACACTTCCTTAACTGGGACAATGAAGCGGAGATGATCGAGAAAATTGCAAGAGATGTATCGGAAAAACTGAATATGACACCGTCTAGTGATTTTGATGGCATGGTTGGGATTGAAGCTCATTTGAAGGAGATGGAGGTTTTGCTAGACTTTGATTATGATGGAGTTAAGATTGTTGGAATCTTTGGTCCTGCAGGTATTGGTAAGACAACTATTGCGAGAGCTTTGCATAGTCTACTACTCTTTAAGAAGTTTCAGCTTACTTGTTTTGTTGATAACCTTAGAGGAAGCTATCCCATTGGTATTGATGAGTATGGTTTGAAGTTGCGTTTACAAGAACACCTTCTTTCAAAGATTTTGAACCAAGATGGTATGAGGATAAGCCATTTAGGTGCGGTAAAAGAGAGGTTATGCGACATGAAAGTGCTTATCATTCTTGATGATGTGAATGATGTGAAGCAATTAGAGGCTTTGGCTAATGACACTACTTGGTTTGGTCCTGGAAGTAGGGTTATTGTGACAACAGAAAACAAAGAGATTTTGCAGCGGCATGGTATCGATAATATGTACCATGTGGGCTTTCCTTCTGACGAAAAAGCTATGGAGATCTTATGTGGATATGCTTTTAAACAAAGCTCTCCACGTCCTGGTTTTAACTATCTTGCACAAAAGGTAACATGGCTTTGTGGTAACCTTCCTTTGGGTCTACGTGTGGTTGGTTCATCTTTACGTGGGAAGAAGGAGGACGAATGGAAATCTGTGATACGAAGGCTAGACACTATTATTGATAGAGATATCGAAGACGTACTAAGAGTTGGCTACGAAAGTTTACATGAGAATGAGCAATCTCTGTTTCTCCACATTGCAGTCTTCTTCAACTGCAAAGATGTTGATCTTGTGAAAGCCATGCTTGCTGACGATAACTTGGATATCGCACACGGGTTGAAAATCTTGGTAAACAAATCTCTCATATATATATCTACCACTGGGGAAATAAGAATGCACAAGTTGCTACAACAAGTGGGCAGACAAGCCATTAACAGACAAGAGCCTTGGAAACGCTTGATCTTAACTAATGCTCAAGAGATTTGTTATGTCCTTGAAAATGATAAAGGTACTGGAGTTGTGTCTGGCATATCATTTGATACATCAGGAATTAGCGAAGTGATTTTAAGCAATAGAGCTCTTAGAAGAATGTCTAATCTCCGATTCCTAAGTGTTTACAAGACAAGACATGATGGGAATAATATAATGCATATACCTGAGGACATGAAGTTTCCACCTCGCCTAAGGTTACTACATTGGGAAGCATATCCGAGCAAGAGTCTTCCTCTTGGATTTTGCCTGGAAAATCTTGTCGAACTCAATATGAAAGATAGCCAGCTCGAAAAGCTCTGGGAAGGAACTCAGCTGTTGACAAATCTTAAGAAGATGGATTTGTCAAGATCAGTTCATTTGAAGGAACTCCCAGATCTTTCAAATGCTACAAACCTGGAGAGACTGGAACTATGTGATTGCAGGGCTTTGGTAGAGCTTCCAAAGTCTATTGGGAATCTTCATAAACTAGAGAACTTAGTGATGGCTAACTGCATAAGTCTAGAAGTCATACCAACTCACATCAACTTGGCATCTCTTGAGCATATCACCATGACTGGATGCTCACGACTGAAAACATTTCCAGATTTTTCTACAAACATTGAGAGACTCCTTCTAATCGGCACATCGGTAGAAGAAGTGCCTGCATCAATCAGGCATTGGTCTTCTCTTTCGGATTTTTGTATAAAAAACAATGAAGATCTTAAGAGCTTAACATATTTTCCAGAGAAGGTAGAGCTGCTAGATCTAAGCTATACTGATATTGAGAAGATTCCAGATTGCATCAAAGGTTTTCATGGGCTAAAGTCTCTTGATGTAGCCGGCTGCAGAAAACTCACATCATTGCCTGAGCTCCCTATGTCACTCGGACTCTTAGTGGCTTTAGATTGTGAATCACTGGAGATAATAACATACCCTTTAAACACTCCAAGTGCGCGACTCAATTTCACCAACTGCTTCAAACTTGGTGAAGAATCAAGGAGACTAATCATCCAACGATGCGCGACTCAGTTTCTTGACGGGTATGCATGCTTACCGGGAAGAGTAATGCCTGATGAGTTCAACCAAAGAACTAGCGGTAATAATTCCTTGAACATTCGTCTTTCTTCTGCATCCTTCAAGTTTAAAGCATGCGTCGTGATTTCACCTAACCAGCAACAACACTCATGGGAACACACTGATATACGGTGTATCGTAGGCAGTTACAATAAAGTTATTTGCGTAGAACACCCAAATGAATCGACCAGAATTCAAACCGAACATTTGTGTATATTTCATGGTAGCGTGTCTGAAGTTAGCAGCAACGAGGCATTGTTTGAATTCTGCATCGATGCCTCGAATCAATTTGATAACTTCAAGATTCTCGAATGTGGTGTACGAATCTTGACTAATGAACCGGAGAGAAGCAGCAAGAAGACCGTCTCTAGGGGGCTCAGGTCCCATGCCAAAATTTTGAAAGCTTGCTTACATAAAAGGAAACAGAAAAAAATGATTGGTTATTTACTAAAAGAGGAATTTGGTTTGCCAAGGGATAACAGGATTATTGAAGTCGATGAGGACAACAACAATGATCATACAGTGAGCTTGGACTCGGCATCAGACAATGTTGAAGGAAAGGAGAAACCTATAGATTGTTGGAGTTGGCTCTGCATCTGCTTTGATCTATCCAATATTGTGAGGAACATGGGAAAGCTTGTGTTGGGTAAGGAAACGACAGAATCCATAGATGGAGGAGTTCTTCACGAATACAGCACTAGGAAAGATGATGACGTGACCATGGGCTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSSSRTWNYRVFASFHGPDVRKSFLSHFRKQFICNGITMFDDQKIVRSQTIAPSLTQGIRESKISIVILSKNYASSTWCLNELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGTVFNKTCARRTEKERRNWSQALNVVGNIAGEHFLNWDNEAEMIEKIARDVSEKLNMTPSSDFDGMVGIEAHLKEMEVLLDFDYDGVKIVGIFGPAGIGKTTIARALHSLLLFKKFQLTCFVDNLRGSYPIGIDEYGLKLRLQEHLLSKILNQDGMRISHLGAVKERLCDMKVLIILDDVNDVKQLEALANDTTWFGPGSRVIVTTENKEILQRHGIDNMYHVGFPSDEKAMEILCGYAFKQSSPRPGFNYLAQKVTWLCGNLPLGLRVVGSSLRGKKEDEWKSVIRRLDTIIDRDIEDVLRVGYESLHENEQSLFLHIAVFFNCKDVDLVKAMLADDNLDIAHGLKILVNKSLIYISTTGEIRMHKLLQQVGRQAINRQEPWKRLILTNAQEICYVLENDKGTGVVSGISFDTSGISEVILSNRALRRMSNLRFLSVYKTRHDGNNIMHIPEDMKFPPRLRLLHWEAYPSKSLPLGFCLENLVELNMKDSQLEKLWEGTQLLTNLKKMDLSRSVHLKELPDLSNATNLERLELCDCRALVELPKSIGNLHKLENLVMANCISLEVIPTHINLASLEHITMTGCSRLKTFPDFSTNIERLLLIGTSVEEVPASIRHWSSLSDFCIKNNEDLKSLTYFPEKVELLDLSYTDIEKIPDCIKGFHGLKSLDVAGCRKLTSLPELPMSLGLLVALDCESLEIITYPLNTPSARLNFTNCFKLGEESRRLIIQRCATQFLDGYACLPGRVMPDEFNQRTSGNNSLNIRLSSASFKFKACVVISPNQQQHSWEHTDIRCIVGSYNKVICVEHPNESTRIQTEHLCIFHGSVSEVSSNEALFEFCIDASNQFDNFKILECGVRILTNEPERSSKKTVSRGLRSHAKILKACLHKRKQKKMIGYLLKEEFGLPRDNRIIEVDEDNNNDHTVSLDSASDNVEGKEKPIDCWSWLCICFDLSNIVRNMGKLVLGKETTESIDGGVLHEYSTRKDDDVTMG

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
8-143 G3DSA:3.40.50.10140

RTWNYRVFASFHGPDVRKSFLSHFRKQFICNGITMFDDQKIVRSQTIAPSLTQGIRESKISIVILSKNYASSTWCLNELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGTVFNKTCARRTEKERRNWSQALN

ProfileScan: PS50104
IPR000157
10-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WNYRVFASFHGPDVRKSFLSHFRKQFICNGITMFDDQKIVRSQTIAPSLTQGIRESKISIVILSKNYASSTWCLNELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGTVFNKTCARRTEKERRNWSQALNVVGNI

HMMSmart: SM00255
IPR000157
11-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

NYRVFASFHGPDVRKSFLSHFRKQFICNGITMFDDQKIVRSQTIAPSLTQGIRESKISIVILSKNYASSTWCLNELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGTVFNKTCARRTEKERRNWSQALNVVGNI

HMMPfam: PF01582
IPR000157
14-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFASFHGPDVRKSFLSHFRKQFICNGITMFDDQKIVRSQTIAPSLTQGIRESKISIVILSKNYASSTWCLNELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGTVFNKTCARRTEKERRNWSQALN

HMMPanther: PTHR11017
34-991 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QFICNGITMFDDQKIVRSQTIAPSLTQGIRESKISIVILSKNYASSTWCLNELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGTVFNKTCARRTEKERRNWSQALNVVGNIAGEHFLNWDNEAEMIEKIARDVSEKLNMTPSSDFDGMVGIEAHLKEMEVLLDFDYDGVKIVGIFGPAGIGKTTIARALHSLLLFKKFQLTCFVDNLRGSYPIGIDEYGLKLRLQEHLLSKILNQDGMRISHLGAVKERLCDMKVLIILDDVNDVKQLEALANDTTWFGPGSRVIVTTENKEILQRHGIDNMYHVGFPSDEKAMEILCGYAFKQSSPRPGFNYLAQKVTWLCGNLPLGLRVVGSSLRGKKEDEWKSVIRRLDTIIDRDIEDVLRVGYESLHENEQSLFLHIAVFFNCKDVDLVKAMLADDNLDIAHGLKILVNKSLIYISTTGEIRMHKLLQQVGRQAINRQEPWKRLILTNAQEICYVLENDKGTGVVSGISFDTSGISEVILSNRALRRMSNLRFLSVYKTRHDGNNIMHIPEDMKFPPRLRLLHWEAYPSKSLPLGFCLENLVELNMKDSQLEKLWEGTQLLTNLKKMDLSRSVHLKELPDLSNATNLERLELCDCRALVELPKSIGNLHKLENLVMANCISLEVIPTHINLASLEHITMTGCSRLKTFPDFSTNIERLLLIGTSVEEVPASIRHWSSLSDFCIKNNEDLKSLTYFPEKVELLDLSYTDIEKIPDCIKGFHGLKSLDVAGCRKLTSLPELPMSLGLLVALDCESLEIITYPLNTPSARLNFTNCFKLGEESRRLIIQRCATQFLDGYACLPGRVMPDEFNQRTSGNNSLNIRLSSASFKFKACVVISPNQQQHSWEHTDIRCIVGSYNKVICVEHPNESTRIQTEHLCIFHGSVSEVSSNEALFEFCIDASNQFDNFKILECGVRILTNEPERSSKKTVSR

HMMPanther: PTHR11017:SF20
34-991 PTHR11017:SF20,SUBFAMILY NOT NAMED

QFICNGITMFDDQKIVRSQTIAPSLTQGIRESKISIVILSKNYASSTWCLNELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGTVFNKTCARRTEKERRNWSQALNVVGNIAGEHFLNWDNEAEMIEKIARDVSEKLNMTPSSDFDGMVGIEAHLKEMEVLLDFDYDGVKIVGIFGPAGIGKTTIARALHSLLLFKKFQLTCFVDNLRGSYPIGIDEYGLKLRLQEHLLSKILNQDGMRISHLGAVKERLCDMKVLIILDDVNDVKQLEALANDTTWFGPGSRVIVTTENKEILQRHGIDNMYHVGFPSDEKAMEILCGYAFKQSSPRPGFNYLAQKVTWLCGNLPLGLRVVGSSLRGKKEDEWKSVIRRLDTIIDRDIEDVLRVGYESLHENEQSLFLHIAVFFNCKDVDLVKAMLADDNLDIAHGLKILVNKSLIYISTTGEIRMHKLLQQVGRQAINRQEPWKRLILTNAQEICYVLENDKGTGVVSGISFDTSGISEVILSNRALRRMSNLRFLSVYKTRHDGNNIMHIPEDMKFPPRLRLLHWEAYPSKSLPLGFCLENLVELNMKDSQLEKLWEGTQLLTNLKKMDLSRSVHLKELPDLSNATNLERLELCDCRALVELPKSIGNLHKLENLVMANCISLEVIPTHINLASLEHITMTGCSRLKTFPDFSTNIERLLLIGTSVEEVPASIRHWSSLSDFCIKNNEDLKSLTYFPEKVELLDLSYTDIEKIPDCIKGFHGLKSLDVAGCRKLTSLPELPMSLGLLVALDCESLEIITYPLNTPSARLNFTNCFKLGEESRRLIIQRCATQFLDGYACLPGRVMPDEFNQRTSGNNSLNIRLSSASFKFKACVVISPNQQQHSWEHTDIRCIVGSYNKVICVEHPNESTRIQTEHLCIFHGSVSEVSSNEALFEFCIDASNQFDNFKILECGVRILTNEPERSSKKTVSR

superfamily: SSF52540
65-436 SSF52540

SKISIVILSKNYASSTWCLNELLEILKCREDIGQIVMTVFYGVDPSDVRKQTGEFGTVFNKTCARRTEKERRNWSQALNVVGNIAGEHFLNWDNEAEMIEKIARDVSEKLNMTPSSDFDGMVGIEAHLKEMEVLLDFDYDGVKIVGIFGPAGIGKTTIARALHSLLLFKKFQLTCFVDNLRGSYPIGIDEYGLKLRLQEHLLSKILNQDGMRISHLGAVKERLCDMKVLIILDDVNDVKQLEALANDTTWFGPGSRVIVTTENKEILQRHGIDNMYHVGFPSDEKAMEILCGYAFKQSSPRPGFNYLAQKVTWLCGNLPLGLRVVGSSLRGKKEDEWKSVIRRLDTIIDRDIEDVLRVGYESLHENEQSLFL

Gene3D: G3DSA:3.40.50.300
175-220 G3DSA:3.40.50.300

NMTPSSDFDGMVGIEAHLKEMEVLLDFDYDGVKIVGIFGPAGIGKT

HMMPfam: PF00931
IPR002182
195-448 NB-ARC,NBS
NB-ARC

MEVLLDFDYDGVKIVGIFGPAGIGKTTIARALHSLLLFKKFQLTCFVDNLRGSYPIGIDEYGLKLRLQEHLLSKILNQDGMRISHLGAVKERLCDMKVLIILDDVNDVKQLEALANDTTWFGPGSRVIVTTENKEILQRHGIDNMYHVGFPSDEKAMEILCGYAFKQSSPRPGFNYLAQKVTWLCGNLPLGLRVVGSSLRGKKEDEWKSVIRRLDTIIDRDIEDVLRVGYESLHENEQSLFLHIAVFFNCKDVD

HMMSmart: SM00382
IPR003593
205-346 AAA,NBS
AAA+ ATPase domain

GVKIVGIFGPAGIGKTTIARALHSLLLFKKFQLTCFVDNLRGSYPIGIDEYGLKLRLQEHLLSKILNQDGMRISHLGAVKERLCDMKVLIILDDVNDVKQLEALANDTTWFGPGSRVIVTTENKEILQRHGIDNMYHVGFPS

FPrintScan: PR00364
IPR000767
208-223 DISEASERSIST
Disease resistance protein

IVGIFGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
221-335 G3DSA:3.40.50.300

TIARALHSLLLFKKFQLTCFVDNLRGSYPIGIDEYGLKLRLQEHLLSKILNQDGMRISHLGAVKERLCDMKVLIILDDVNDVKQLEALANDTTWFGPGSRVIVTTENKEILQRHG

FPrintScan: PR00364
IPR000767
286-300 DISEASERSIST
Disease resistance protein

RLCDMKVLIILDDVN

FPrintScan: PR00364
IPR000767
379-393 DISEASERSIST
Disease resistance protein

CGNLPLGLRVVGSSL

superfamily: SSF46785
414-518 SSF46785

RDIEDVLRVGYESLHENEQSLFLHIAVFFNCKDVDLVKAMLADDNLDIAHGLKILVNKSLIYISTTGEIRMHKLLQQVGRQAINRQEPWKRLILTNAQEICYVLE

superfamily: SSF52058
513-837 SSF52058,LRR

ICYVLENDKGTGVVSGISFDTSGISEVILSNRALRRMSNLRFLSVYKTRHDGNNIMHIPEDMKFPPRLRLLHWEAYPSKSLPLGFCLENLVELNMKDSQLEKLWEGTQLLTNLKKMDLSRSVHLKELPDLSNATNLERLELCDCRALVELPKSIGNLHKLENLVMANCISLEVIPTHINLASLEHITMTGCSRLKTFPDFSTNIERLLLIGTSVEEVPASIRHWSSLSDFCIKNNEDLKSLTYFPEKVELLDLSYTDIEKIPDCIKGFHGLKSLDVAGCRKLTSLPELPMSLGLLVALDCESLEIITYPLNTPSARLNFTNCFKL

Gene3D: G3DSA:3.80.10.10
532-821 G3DSA:3.80.10.10

DTSGISEVILSNRALRRMSNLRFLSVYKTRHDGNNIMHIPEDMKFPPRLRLLHWEAYPSKSLPLGFCLENLVELNMKDSQLEKLWEGTQLLTNLKKMDLSRSVHLKELPDLSNATNLERLELCDCRALVELPKSIGNLHKLENLVMANCISLEVIPTHINLASLEHITMTGCSRLKTFPDFSTNIERLLLIGTSVEEVPASIRHWSSLSDFCIKNNEDLKSLTYFPEKVELLDLSYTDIEKIPDCIKGFHGLKSLDVAGCRKLTSLPELPMSLGLLVALDCESLEIITYP

HMMPfam: PF07725
IPR011713
601-620 LRR_3
Leucine-rich repeat 3

NLVELNMKDSQLEKLWEGTQ

FPrintScan: PR00364
IPR000767
620-636 DISEASERSIST
Disease resistance protein

QLLTNLKKMDLSRSVHL

HMMPfam: PF13504
782-798 LRR_7,Leucine rich repeat

GLKSLDVAGCRKLTSLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox