PRGDB00047080 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145359966 (NM_126980)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT2G14080) mRNA, complete cds.

DNA Sequence

ATGGATTTTTACGTTTTCCTTGGGACTGTTGCTGCTACGTTCTTCACTCTTTTGGGTACAATATTTTATATGATTTATGGAAAATTTCGAGTCCAAGAAACTATAATAACTACTTCTTCTTCACCTCCTACATCTCCCCAATCTTCTTTGTCTTGTAACCAGAAACACGATGTCTTCCCCAGCTTCCACGGGGCAGATGTGCGCAAATCATTTCTCAGTCACATTTTGAAAGAGTTTAAAAGAAAAGGGATCGATACGTTCATTGATAATAATATTGAGAGGAGCAAATCGATCGGTCCAGAACTCATAGAAGCAATCAAAGGATCTAAGATTGCAGTTGTCTTGCTCTCGAAGGACTACGCTTCCTCGTCGTGGTGCCTGAACGAGTTGGTGGAGATCATGAAGTGTAGGAAAATGTTGGATCAAACAGTGATGACAATTTTCTATGAAGTGGATCCAACTGATGTAAAGAAGCAAACCGGAGACTTTGGGAAGGTCTTCAAGAAAACTTGTATGGGTAAAACAAATGCAGTTAGTCGAAAATGGATCGAGGCTTTGAGTGAAGTAGCCACAATAGCTGGAGAGCATTCAATAAATTGGGATACCGAAGCTGCCATGATCGAAAAAATCTCTACTGATATCTCGAACAAGCTGAATAATTCCACACCACTAAGGGATTTTGACGGTTTAGTTGGGATGGGAGCTCATATGGAAAAGTTGGAATTGTTGCTCTGCCTAGACTCTTGTGAAGTGAGGATGATTGGAATTTGGGGTCCTCCAGGGATTGGTAAAACCACCATCGTCAGATTTTTATATAACCAACTCTCAAGCAGTTTCGAGTTGAGCATCTTCATGGAGAATATCAAAACGATGCATACAATACTAGCTTCTTCAGATGACTATAGCGCGAAGTTGATCTTACAACGACAGTTTTTGTCAAAAATACTCGACCATAAAGATATTGAGATTCCTCACTTAAGAGTTCTGCAAGAACGTTTATATAACAAGAAAGTGCTTGTCGTTCTTGATGACGTGGATCAATCAGTACAACTAGATGCCTTGGCCAAAGAAACTCGGTGGTTTGGTCCTAGAAGTCGGATTCTAATCACAACCCAAGATAGGAAACTTTTGAAGGCACATAGGATCAACAATATTTACAAGGTGGATCTTCCAAATTCTGATGATGCTCTTCAAATCTTCTGCATGTATGCGTTTGGTCAAAAGACCCCATATGATGGTTTTTACAAGCTTGCGAGGAAAGTTACATGGCTTGTTGGTAACTTTCCTTTGGGATTAAGGGTTGTGGGATCATATTTTCGAGAAATGTCCAAGCAGGAGTGGAGAAAGGAAATACCAAGGCTAAGGGCTCGCCTTGATGGAAAAATTGAGAGCGTTTTGAAGTTTAGTTATGATGCCTTATGTGATGAAGACAAAGATTTATTTCTTCATATAGCATGTTTTTTCAACCATGAAAGTATTGAGAAACTAGAAGATTTTCTTGGGAAAACATTCTTGGACATTGCTCAAAGGTTTCACGTCTTAGCTGAGAAATCGCTCATATCTATCAACTCAAACTTTGTCGAGATGCATGATTCTCTAGCGCAACTAGGTAAAGAAATTGTTCGTAAACAATCTGTTCGGGAGCCAGGGCAACGCCAATTTTTAGTTGATGCTAGAGATATTTCTGAAGTACTCGCCGACGATACAGCAGGTGGTAGAAGTGTTATAGGGATATATCTCGACTTACATCGGAACGATGACGTATTCAATATAAGTGAAAAAGCTTTTGAAGGAATGTCCAATCTCCAATTCTTAAGAGTCAAAAATTTTGGTAATCTTTTTCCTGCAATAGTGTGTTTACCACACTGTTTGACCTATATATCTCGAAAACTTCGATTACTAGATTGGATGTATTTTCCGATGACATGCTTTCCTTCAAAGTTCAATCCTGAGTTCCTCGTGGAACTAAACATGTGGGGCTCCAAGCTTGAGAAGTTATGGGAAGAGATTCAACCTCTTAGAAATCTCAAGCGGATGGATTTGTTTTCTTCTAAAAACCTAAAAGAACTTCCTGATCTCTCAAGTGCTACTAACCTCGAGGTGTTGAATCTTAACGGATGCTCAAGTCTAGTGGAGTTGCCCTTCTCTATTGGGAATGCAACTAAACTCCTAAAATTGGAGCTTAGTGGATGCTCAAGTCTCTTGGAGCTTCCATCCTCTATCGGAAATGCCATTAATCTTCAGACGATTGATTTTAGTCATTGTGAAAATCTGGTGGAGCTTCCATCCTCTATTGGGAATGCCACTAATCTAAAGGAGTTGGACCTTAGTTGTTGCTCAAGTCTGAAGGAGCTTCCCTCCTCTATTGGGAATTGCACTAATCTTAAGAAGTTGCACCTTATTTGTTGCTCAAGTCTGAAGGAGCTTCCCTCCTCTATTGGGAATTGCACTAATCTTAAGGAGTTGCACCTTACTTGTTGCTCAAGTCTGATAAAGCTTCCATCCTCTATCGGGAATGCCATTAACCTGGAGAAGTTGATACTCGCTGGATGCGAAAGTTTGGTGGAGCTCCCTTCCTTTATTGGAAAAGCCACTAATCTCAAGATTCTGAATCTTGGATATCTCTCATGTCTGGTGGAGTTACCCTCCTTTATTGGAAACCTTCATAAGTTGTCTGAACTAAGGCTGAGAGGATGCAAAAAGCTACAAGTTCTTCCGACCAATATCAACTTGGAATTTCTTAATGAACTTGATCTCACAGATTGCATCTTGTTGAAAACATTTCCGGTGATCTCCACAAACATTAAACGTCTCCATCTTAGGGGGACTCAGATAGAAGAAGTTCCTTCGTCCCTCAGGTCATGGCCTCGCCTTGAGGATTTGCAAATGCTATACAGTGAAAACCTCAGTGAATTCTCACATGTTCTTGAGAGGATCACAGTGCTGGAATTGAGTGATATAAATATACGAGAAATGACCCCATGGCTCAATAGAATCACTCGTCTACGTCGATTAAAACTCAGCGGATGCGGAAAACTGGTATCACTCCCACAACTTTCGGATTCCCTAATAATTCTGGATGCAGAGAATTGTGGCTCTCTTGAGAGACTAGGTTGCTCTTTTAACAATCCAAATATTAAATGTCTCGACTTTACCAACTGCCTCAAACTAGATAAAGAAGCAAGAGACCTTATCATTCAAGCAACGGCTCGTCATTATTCTATCTTACCCAGTAGAGAAGTTCATGAGTACATCACTAACCGAGCCATTGGAAGTTCTCTTACTGTGAAGTTGAATCAAAGGGCTCTTCCTACATCCATGAGATTTAAGGCTTGCATTGTTTTGGCTGATAATGGTGGCCGTGAAGCTGGTAATGAGGGACGTATGGAGGTATATATGACCATTATGGAAAGGCAGAATGATTTCATCACTTCTACGTATGTATCACTAAACCATATTTTTCCAGAATTTCTAAGGGAGCATATGTACACAGTCGAAGTTTTAGTTGACGTTGAGGTGACTTCGGATGAGCTTGTCTTTGATTTCCAGCTCAACAGTGAGAAATGGGAGATAGGAGAATGTGGGGTACTCGAACTGAAGAACCATGTTCAAACATTTTCGGAAATTGATTCTTGGGACAATTATTAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MDFYVFLGTVAATFFTLLGTIFYMIYGKFRVQETIITTSSSPPTSPQSSLSCNQKHDVFPSFHGADVRKSFLSHILKEFKRKGIDTFIDNNIERSKSIGPELIEAIKGSKIAVVLLSKDYASSSWCLNELVEIMKCRKMLDQTVMTIFYEVDPTDVKKQTGDFGKVFKKTCMGKTNAVSRKWIEALSEVATIAGEHSINWDTEAAMIEKISTDISNKLNNSTPLRDFDGLVGMGAHMEKLELLLCLDSCEVRMIGIWGPPGIGKTTIVRFLYNQLSSSFELSIFMENIKTMHTILASSDDYSAKLILQRQFLSKILDHKDIEIPHLRVLQERLYNKKVLVVLDDVDQSVQLDALAKETRWFGPRSRILITTQDRKLLKAHRINNIYKVDLPNSDDALQIFCMYAFGQKTPYDGFYKLARKVTWLVGNFPLGLRVVGSYFREMSKQEWRKEIPRLRARLDGKIESVLKFSYDALCDEDKDLFLHIACFFNHESIEKLEDFLGKTFLDIAQRFHVLAEKSLISINSNFVEMHDSLAQLGKEIVRKQSVREPGQRQFLVDARDISEVLADDTAGGRSVIGIYLDLHRNDDVFNISEKAFEGMSNLQFLRVKNFGNLFPAIVCLPHCLTYISRKLRLLDWMYFPMTCFPSKFNPEFLVELNMWGSKLEKLWEEIQPLRNLKRMDLFSSKNLKELPDLSSATNLEVLNLNGCSSLVELPFSIGNATKLLKLELSGCSSLLELPSSIGNAINLQTIDFSHCENLVELPSSIGNATNLKELDLSCCSSLKELPSSIGNCTNLKKLHLICCSSLKELPSSIGNCTNLKELHLTCCSSLIKLPSSIGNAINLEKLILAGCESLVELPSFIGKATNLKILNLGYLSCLVELPSFIGNLHKLSELRLRGCKKLQVLPTNINLEFLNELDLTDCILLKTFPVISTNIKRLHLRGTQIEEVPSSLRSWPRLEDLQMLYSENLSEFSHVLERITVLELSDINIREMTPWLNRITRLRRLKLSGCGKLVSLPQLSDSLIILDAENCGSLERLGCSFNNPNIKCLDFTNCLKLDKEARDLIIQATARHYSILPSREVHEYITNRAIGSSLTVKLNQRALPTSMRFKACIVLADNGGREAGNEGRMEVYMTIMERQNDFITSTYVSLNHIFPEFLREHMYTVEVLVDVEVTSDELVFDFQLNSEKWEIGECGVLELKNHVQTFSEIDSWDNY

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
44-195 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TSPQSSLSCNQKHDVFPSFHGADVRKSFLSHILKEFKRKGIDTFIDNNIERSKSIGPELIEAIKGSKIAVVLLSKDYASSSWCLNELVEIMKCRKMLDQTVMTIFYEVDPTDVKKQTGDFGKVFKKTCMGKTNAVSRKWIEALSEVATIAGE

Gene3D: G3DSA:3.40.50.10140
53-184 G3DSA:3.40.50.10140

NQKHDVFPSFHGADVRKSFLSHILKEFKRKGIDTFIDNNIERSKSIGPELIEAIKGSKIAVVLLSKDYASSSWCLNELVEIMKCRKMLDQTVMTIFYEVDPTDVKKQTGDFGKVFKKTCMGKTNAVSRKWIE

ProfileScan: PS50104
IPR000157
54-192 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QKHDVFPSFHGADVRKSFLSHILKEFKRKGIDTFIDNNIERSKSIGPELIEAIKGSKIAVVLLSKDYASSSWCLNELVEIMKCRKMLDQTVMTIFYEVDPTDVKKQTGDFGKVFKKTCMGKTNAVSRKWIEALSEVATI

HMMSmart: SM00255
IPR000157
55-192 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHDVFPSFHGADVRKSFLSHILKEFKRKGIDTFIDNNIERSKSIGPELIEAIKGSKIAVVLLSKDYASSSWCLNELVEIMKCRKMLDQTVMTIFYEVDPTDVKKQTGDFGKVFKKTCMGKTNAVSRKWIEALSEVATI

HMMPfam: PF01582
IPR000157
58-187 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRKSFLSHILKEFKRKGIDTFIDNNIERSKSIGPELIEAIKGSKIAVVLLSKDYASSSWCLNELVEIMKCRKMLDQTVMTIFYEVDPTDVKKQTGDFGKVFKKTCMGKTNAVSRKWIEALS

HMMPanther: PTHR23155
66-1087 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKSFLSHILKEFKRKGIDTFIDNNIERSKSIGPELIEAIKGSKIAVVLLSKDYASSSWCLNELVEIMKCRKMLDQTVMTIFYEVDPTDVKKQTGDFGKVFKKTCMGKTNAVSRKWIEALSEVATIAGEHSINWDTEAAMIEKISTDISNKLNNSTPLRDFDGLVGMGAHMEKLELLLCLDSCEVRMIGIWGPPGIGKTTIVRFLYNQLSSSFELSIFMENIKTMHTILASSDDYSAKLILQRQFLSKILDHKDIEIPHLRVLQERLYNKKVLVVLDDVDQSVQLDALAKETRWFGPRSRILITTQDRKLLKAHRINNIYKVDLPNSDDALQIFCMYAFGQKTPYDGFYKLARKVTWLVGNFPLGLRVVGSYFREMSKQEWRKEIPRLRARLDGKIESVLKFSYDALCDEDKDLFLHIACFFNHESIEKLEDFLGKTFLDIAQRFHVLAEKSLISINSNFVEMHDSLAQLGKEIVRKQSVREPGQRQFLVDARDISEVLADDTAGGRSVIGIYLDLHRNDDVFNISEKAFEGMSNLQFLRVKNFGNLFPAIVCLPHCLTYISRKLRLLDWMYFPMTCFPSKFNPEFLVELNMWGSKLEKLWEEIQPLRNLKRMDLFSSKNLKELPDLSSATNLEVLNLNGCSSLVELPFSIGNATKLLKLELSGCSSLLELPSSIGNAINLQTIDFSHCENLVELPSSIGNATNLKELDLSCCSSLKELPSSIGNCTNLKKLHLICCSSLKELPSSIGNCTNLKELHLTCCSSLIKLPSSIGNAINLEKLILAGCESLVELPSFIGKATNLKILNLGYLSCLVELPSFIGNLHKLSELRLRGCKKLQVLPTNINLEFLNELDLTDCILLKTFPVISTNIKRLHLRGTQIEEVPSSLRSWPRLEDLQMLYSENLSEFSHVLERITVLELSDINIREMTPWLNRITRLRRLKLSGCGKLVSLPQLSDSLIILDAENCGSLERLGCSFNNPNIKCLDFTNCLKLDKEARDLIIQATARHYSILPSREVHEYITN

HMMPanther: PTHR23155:SF295
66-1087 PTHR23155:SF295,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

DVRKSFLSHILKEFKRKGIDTFIDNNIERSKSIGPELIEAIKGSKIAVVLLSKDYASSSWCLNELVEIMKCRKMLDQTVMTIFYEVDPTDVKKQTGDFGKVFKKTCMGKTNAVSRKWIEALSEVATIAGEHSINWDTEAAMIEKISTDISNKLNNSTPLRDFDGLVGMGAHMEKLELLLCLDSCEVRMIGIWGPPGIGKTTIVRFLYNQLSSSFELSIFMENIKTMHTILASSDDYSAKLILQRQFLSKILDHKDIEIPHLRVLQERLYNKKVLVVLDDVDQSVQLDALAKETRWFGPRSRILITTQDRKLLKAHRINNIYKVDLPNSDDALQIFCMYAFGQKTPYDGFYKLARKVTWLVGNFPLGLRVVGSYFREMSKQEWRKEIPRLRARLDGKIESVLKFSYDALCDEDKDLFLHIACFFNHESIEKLEDFLGKTFLDIAQRFHVLAEKSLISINSNFVEMHDSLAQLGKEIVRKQSVREPGQRQFLVDARDISEVLADDTAGGRSVIGIYLDLHRNDDVFNISEKAFEGMSNLQFLRVKNFGNLFPAIVCLPHCLTYISRKLRLLDWMYFPMTCFPSKFNPEFLVELNMWGSKLEKLWEEIQPLRNLKRMDLFSSKNLKELPDLSSATNLEVLNLNGCSSLVELPFSIGNATKLLKLELSGCSSLLELPSSIGNAINLQTIDFSHCENLVELPSSIGNATNLKELDLSCCSSLKELPSSIGNCTNLKKLHLICCSSLKELPSSIGNCTNLKELHLTCCSSLIKLPSSIGNAINLEKLILAGCESLVELPSFIGKATNLKILNLGYLSCLVELPSFIGNLHKLSELRLRGCKKLQVLPTNINLEFLNELDLTDCILLKTFPVISTNIKRLHLRGTQIEEVPSSLRSWPRLEDLQMLYSENLSEFSHVLERITVLELSDINIREMTPWLNRITRLRRLKLSGCGKLVSLPQLSDSLIILDAENCGSLERLGCSFNNPNIKCLDFTNCLKLDKEARDLIIQATARHYSILPSREVHEYITN

superfamily: SSF52540
109-482 SSF52540

SKIAVVLLSKDYASSSWCLNELVEIMKCRKMLDQTVMTIFYEVDPTDVKKQTGDFGKVFKKTCMGKTNAVSRKWIEALSEVATIAGEHSINWDTEAAMIEKISTDISNKLNNSTPLRDFDGLVGMGAHMEKLELLLCLDSCEVRMIGIWGPPGIGKTTIVRFLYNQLSSSFELSIFMENIKTMHTILASSDDYSAKLILQRQFLSKILDHKDIEIPHLRVLQERLYNKKVLVVLDDVDQSVQLDALAKETRWFGPRSRILITTQDRKLLKAHRINNIYKVDLPNSDDALQIFCMYAFGQKTPYDGFYKLARKVTWLVGNFPLGLRVVGSYFREMSKQEWRKEIPRLRARLDGKIESVLKFSYDALCDEDKDLFL

Gene3D: G3DSA:3.40.50.300
228-265 G3DSA:3.40.50.300

DGLVGMGAHMEKLELLLCLDSCEVRMIGIWGPPGIGKT

HMMPfam: PF00931
IPR002182
236-495 NB-ARC,NBS
NB-ARC

HMEKLELLLCLDSCEVRMIGIWGPPGIGKTTIVRFLYNQLSSSFELSIFMENIKTMHTILASSDDYSAKLILQRQFLSKILDHKDIEIPHLRVLQERLYNKKVLVVLDDVDQSVQLDALAKETRWFGPRSRILITTQDRKLLKAHRINNIYKVDLPNSDDALQIFCMYAFGQKTPYDGFYKLARKVTWLVGNFPLGLRVVGSYFREMSKQEWRKEIPRLRARLDGKIESVLKFSYDALCDEDKDLFLHIACFFNHESIEK

HMMSmart: SM00382
IPR003593
250-392 AAA,NBS
AAA+ ATPase domain

EVRMIGIWGPPGIGKTTIVRFLYNQLSSSFELSIFMENIKTMHTILASSDDYSAKLILQRQFLSKILDHKDIEIPHLRVLQERLYNKKVLVVLDDVDQSVQLDALAKETRWFGPRSRILITTQDRKLLKAHRINNIYKVDLPN

FPrintScan: PR00364
IPR000767
253-268 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIV

Gene3D: G3DSA:3.40.50.300
266-302 G3DSA:3.40.50.300

TIVRFLYNQLSSSFELSIFMENIKTMHTILASSDDYS

FPrintScan: PR00364
IPR000767
332-346 DISEASERSIST
Disease resistance protein

RLYNKKVLVVLDDVD

Gene3D: G3DSA:3.40.50.300
337-401 G3DSA:3.40.50.300

KVLVVLDDVDQSVQLDALAKETRWFGPRSRILITTQDRKLLKAHRINNIYKVDLPNSDDALQIFC

FPrintScan: PR00364
IPR000767
425-439 DISEASERSIST
Disease resistance protein

VGNFPLGLRVVGSYF

superfamily: SSF52058
528-851 SSF52058,LRR

EMHDSLAQLGKEIVRKQSVREPGQRQFLVDARDISEVLADDTAGGRSVIGIYLDLHRNDDVFNISEKAFEGMSNLQFLRVKNFGNLFPAIVCLPHCLTYISRKLRLLDWMYFPMTCFPSKFNPEFLVELNMWGSKLEKLWEEIQPLRNLKRMDLFSSKNLKELPDLSSATNLEVLNLNGCSSLVELPFSIGNATKLLKLELSGCSSLLELPSSIGNAINLQTIDFSHCENLVELPSSIGNATNLKELDLSCCSSLKELPSSIGNCTNLKKLHLICCSSLKELPSSIGNCTNLKELHLTCCSSLIKLPSSIGNAINLEKLILAGC

Gene3D: G3DSA:3.80.10.10
580-769 G3DSA:3.80.10.10

LDLHRNDDVFNISEKAFEGMSNLQFLRVKNFGNLFPAIVCLPHCLTYISRKLRLLDWMYFPMTCFPSKFNPEFLVELNMWGSKLEKLWEEIQPLRNLKRMDLFSSKNLKELPDLSSATNLEVLNLNGCSSLVELPFSIGNATKLLKLELSGCSSLLELPSSIGNAINLQTIDFSHCENLVELPSSIGNAT

HMMPfam: PF07725
IPR011713
652-671 LRR_3
Leucine-rich repeat 3

FLVELNMWGSKLEKLWEEIQ

HMMPfam: PF00560
IPR001611
698-719 LRR_1
Leucine-rich repeat

NLEVLNLNGCSSLVELPFSIGN

HMMPfam: PF00560
IPR001611
746-767 LRR_1
Leucine-rich repeat

NLQTIDFSHCENLVELPSSIGN

FPrintScan: PR00364
IPR000767
766-782 DISEASERSIST
Disease resistance protein

GNATNLKELDLSCCSSL

HMMPfam: PF00560
IPR001611
770-792 LRR_1
Leucine-rich repeat

NLKELDLSCCSSLKELPSSIGNC

Gene3D: G3DSA:3.80.10.10
770-920 G3DSA:3.80.10.10

NLKELDLSCCSSLKELPSSIGNCTNLKKLHLICCSSLKELPSSIGNCTNLKELHLTCCSSLIKLPSSIGNAINLEKLILAGCESLVELPSFIGKATNLKILNLGYLSCLVELPSFIGNLHKLSELRLRGCKKLQVLPTNINLEFLNELDLT

superfamily: SSF52047
808-1076 SSF52047,LRR

ELPSSIGNCTNLKELHLTCCSSLIKLPSSIGNAINLEKLILAGCESLVELPSFIGKATNLKILNLGYLSCLVELPSFIGNLHKLSELRLRGCKKLQVLPTNINLEFLNELDLTDCILLKTFPVISTNIKRLHLRGTQIEEVPSSLRSWPRLEDLQMLYSENLSEFSHVLERITVLELSDINIREMTPWLNRITRLRRLKLSGCGKLVSLPQLSDSLIILDAENCGSLERLGCSFNNPNIKCLDFTNCLKLDKEARDLIIQATARHYSIL

Gene3D: G3DSA:3.80.10.10
921-1064 G3DSA:3.80.10.10

DCILLKTFPVISTNIKRLHLRGTQIEEVPSSLRSWPRLEDLQMLYSENLSEFSHVLERITVLELSDINIREMTPWLNRITRLRRLKLSGCGKLVSLPQLSDSLIILDAENCGSLERLGCSFNNPNIKCLDFTNCLKLDKEARDL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox