PRGDB00047084 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18394505 (NM_101622)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT1G17600) mRNA, complete cds.

DNA Sequence

ATGGTGTCCTCCTCTGCACCTCGTGTATCGAAGTACGACGTCTTCCTCAGCTTCCGTGGAGAAGACACCCGCAAAACCATCGTCAGTCATTTATATGCAGCACTTGATAGCAGAGGCATTGTTACTTTCAAAGATGACCAAAGGCTTGAGATAGGCGATCACATTTCCGATGAACTCCACAGAGCACTAGGGAGTTCGAGTTTCGCTGTTGTTGTTCTCTCCGAGAACTACGCTACTTCGAGATGGTGCTTATTGGAACTTCAACTGATAATGGAGCTTATGAAGGAGGGAAGACTTGAAGTCTTTCCCATCTTCTATGGAGTAGATCCTTCCGTGGTGAGGCATCAGCTAGGAAGTTTCTCTTTAGTAAAGTACCAAGGTCTTGAAATGGTGGATAAGGTTCTCAGGTGGAGAGAAGCTCTTAACCTAATCGCCAATCTTTCAGGCGTGGTTTCAAGCCACTGTGTTGATGAGGCTATAATGGTTGGAGAAATTGCTAGAGATATTTCAAGACGTGTGACATTGATGCATAAAATAGACTCTGGAAATATTGTTGGGATGAAAGCTCACATGGAAGGTCTTAATCATCTCTTGGATCAGGAATCCAATGAGGTTCTCCTGGTAGGAATCTGGGGAATGGGAGGAATTGGGAAAACCTCCATTGTTAAGTGTCTCTATGACCAGCTCTCACCTAAATTTCCAGCTCATTGTTTCATAGAAAACATTAAGAGTGTTAGTAAAGACAATGGCCATGATCTAAAGCATTTGCAAAAAGAATTGCTCTCCAGTATCCTCTGTGATGATATTAGGTTATGGAGCGTGGAAGCTGGATGCCAAGAGATAAAAAAGAGACTTGGGAATCAAAAGGTTTTTCTTGTGCTTGATGGTGTGGATAAAGTGGCGCAGGTGCATGCTTTGGCAAAAGAGAAAAACTGGTTTGGTCCTGGGAGCCGAATTATCATAACCACTCGAGATATGGGCTTGCTCAATACCTGTGGAGTAGAAGTCGTTTATGAGGTTAAGTGCTTGGATGATAAGGATGCCCTCCAGATGTTTAAACAGATTGCTTTTGAAGGAGGACTTCCTCCTTGTGAGGGTTTTGACCAACTCTCAATCCGAGCTTCTAAGCTTGCTCACGGGCTTCCTTCTGCCATTCAAGCCTATGCATTATTTCTCCGTGGAAGGACAGCGAGTCCTGAGGAGTGGGAAGAAGCACTGGGTGCACTTGAAAGCAGTCTTGACGAGAATATAATGGAAATCTTGAAAATTAGCTACGAGGGCTTACCAAAACCACATCAGAATGTATTCCTTCATGTTGTCTGTCTCTTCAATGGAGACACTCTCCAGCGAATCACTTCCCTTCTTCATGGCCCCATACCTCAGAGCAGCCTGTGGATAAGAGTTTTAGCAGAGAAATCTCTCATCAAAATATCAACTAATGGATCTGTTATCATGCACAAGTTGGTCGAACAAATGGGAAGAGAAATTATCCGCGACGACATGTCTTTGGCTCGAAAGTTCCTCAGGGATCCTATGGAAATTCGCGTTGCCCTGGCTTTCAGAGACGGAGGAGAACAAACTGAATGCATGTGCCTACACACGTGTGATATGACCTGTGTGTTATCCATGGAGGCCAGTGTTGTTGGCCGTATGCATAATCTCAAGTTTCTCAAGGTTTACAAGCATGTAGATTACAGAGAGTCGAATCTGCAACTCATTCCAGACCAACCGTTCCTGCCTCGTAGCCTACGGCTATTCCATTGGGATGCATTTCCATTGAGAGCCCTGCCTTCCGGTTCTGATCCATGTTTTCTTGTTGAACTCAATCTGCGTCACAGTGATTTAGAAACTCTCTGGAGTGGAACACCGAGCAATGGTGTGAAAACAGAGAATCCTTGCGAGAAACATAATTCCAACTATTTCCATGTGTTGTTGTATCTTGCTCAGATGTTGAAGAGTTTGAAGAGACTAGATGTGACGGGATCTAAGCATCTCAAGCAACTTCCAGATCTTTCAAGTATCACGAGTCTTGAGGAATTGCTTCTGGAACAATGCACGAGACTGGAGGGCATTCCAGAGTGTATTGGAAAAAGGTCTACCTTAAAGAAGCTTAAGCTATCCTACCGTGGAGGGCGTAGAAGTGCCCTGCGGTTTTTTCTACGAAAATCTACAAGGCAGCAACATATTGGATTGGAGTTCCCAGACGCAAAAGTGAAAATGGATGCACTTATAAACATATCGATTGGGGGAGACATTACTTTTGAGTTTCGTTCAAAATTTAGAGGATATGCTGAATACGTCTCTTTTAATTCTGAGCAACAGATACCCATTATATCGGCGATGAGTCTGCAACAAGCACCTTGGGTCATCTCAGAGTGCAACAGATTCAATTCCCTCCGCATCATGAGGTTCAGCCACAAAGAAAACGGTGAATCTTTCTCCTTTGACGTCTTTCCAGATTTTCCCGACCTGAAAGAGCTAAAACTAGTGAACTTAAACATCAGGAAAATCCCATCTGGGATTTGTCACCTGGATTTACTAGAGAAGCTGGACCTCAGCGGAAATGATTTTGAGAACTTACCAGAAGCTATGAGTAGCCTTTCCCGGTTAAAAACTCTCTGGCTTCAAAACTGCTTTAAGCTCCAGGAGTTGCCAAAGCTAACTCAGGTGCAGACACTTACACTTACCAACTGTAGGAACCTTAGATCATTGGCGAAACTATCTAACACAAGTCAAGATGAGGGAAGATACTGTTTGCTTGAGCTTTGCCTTGAAAATTGCAAGAGTGTTGAATCATTGTCAGATCAGCTTAGTCATTTCACCAAGTTGACATGTTTAGATCTCAGCAACCATGATTTTGAGACATTGCCATCAAGCATCAGAGATCTTACCTCATTGGTAACACTTTGCCTCAATAACTGCAAGAAACTCAAATCGGTGGAAAAACTTCCCTTGTCTCTCCAATTTCTCGATGCACACGGCTGTGATTCTCTCGAAGCTGGTTCTGCAGAACATTTTGAGGACATACCAAACAAGGAGGTGAATACTTGGCTCTTGATCCGTCTCTACTATGATTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MVSSSAPRVSKYDVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEIGDHISDELHRALGSSSFAVVVLSENYATSRWCLLELQLIMELMKEGRLEVFPIFYGVDPSVVRHQLGSFSLVKYQGLEMVDKVLRWREALNLIANLSGVVSSHCVDEAIMVGEIARDISRRVTLMHKIDSGNIVGMKAHMEGLNHLLDQESNEVLLVGIWGMGGIGKTSIVKCLYDQLSPKFPAHCFIENIKSVSKDNGHDLKHLQKELLSSILCDDIRLWSVEAGCQEIKKRLGNQKVFLVLDGVDKVAQVHALAKEKNWFGPGSRIIITTRDMGLLNTCGVEVVYEVKCLDDKDALQMFKQIAFEGGLPPCEGFDQLSIRASKLAHGLPSAIQAYALFLRGRTASPEEWEEALGALESSLDENIMEILKISYEGLPKPHQNVFLHVVCLFNGDTLQRITSLLHGPIPQSSLWIRVLAEKSLIKISTNGSVIMHKLVEQMGREIIRDDMSLARKFLRDPMEIRVALAFRDGGEQTECMCLHTCDMTCVLSMEASVVGRMHNLKFLKVYKHVDYRESNLQLIPDQPFLPRSLRLFHWDAFPLRALPSGSDPCFLVELNLRHSDLETLWSGTPSNGVKTENPCEKHNSNYFHVLLYLAQMLKSLKRLDVTGSKHLKQLPDLSSITSLEELLLEQCTRLEGIPECIGKRSTLKKLKLSYRGGRRSALRFFLRKSTRQQHIGLEFPDAKVKMDALINISIGGDITFEFRSKFRGYAEYVSFNSEQQIPIISAMSLQQAPWVISECNRFNSLRIMRFSHKENGESFSFDVFPDFPDLKELKLVNLNIRKIPSGICHLDLLEKLDLSGNDFENLPEAMSSLSRLKTLWLQNCFKLQELPKLTQVQTLTLTNCRNLRSLAKLSNTSQDEGRYCLLELCLENCKSVESLSDQLSHFTKLTCLDLSNHDFETLPSSIRDLTSLVTLCLNNCKKLKSVEKLPLSLQFLDAHGCDSLEAGSAEHFEDIPNKEVNTWLLIRLYYD

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-150 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

MVSSSAPRVSKYDVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEIGDHISDELHRALGSSSFAVVVLSENYATSRWCLLELQLIMELMKEGRLEVFPIFYGVDPSVVRHQLGSFSLVKYQGLEMVDKVLRWREALNLIANLSGV

Gene3D: G3DSA:3.40.50.10140
10-121 no description

SKYDVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEIGDHISDELHRALGSSSFAVVVLSENYATSRWCLLELQLIMELMKEGRLEVFPIFYGVDPSVVRHQLGSFS

ProfileScan: PS50104
IPR000157
10-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SKYDVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEIGDHISDELHRALGSSSFAVVVLSENYATSRWCLLELQLIMELMKEGRLEVFPIFYGVDPSVVRHQLGSFSLVKYQGLEMVDKVLRWREALNLIANL

HMMSmart: SM00255
IPR000157
11-147 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEIGDHISDELHRALGSSSFAVVVLSENYATSRWCLLELQLIMELMKEGRLEVFPIFYGVDPSVVRHQLGSFSLVKYQGLEMVDKVLRWREALNLIANL

HMMPfam: PF01582
IPR000157
14-141 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEIGDHISDELHRALGSSSFAVVVLSENYATSRWCLLELQLIMELMKEGRLEVFPIFYGVDPSVVRHQLGSFSLVKYQGLEMVDKVLRWREAL

HMMPanther: PTHR23155
23-999 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRKTIVSHLYAALDSRGIVTFKDDQRLEIGDHISDELHRALGSSSFAVVVLSENYATSRWCLLELQLIMELMKEGRLEVFPIFYGVDPSVVRHQLGSFSLVKYQGLEMVDKVLRWREALNLIANLSGVVSSHCVDEAIMVGEIARDISRRVTLMHKIDSGNIVGMKAHMEGLNHLLDQESNEVLLVGIWGMGGIGKTSIVKCLYDQLSPKFPAHCFIENIKSVSKDNGHDLKHLQKELLSSILCDDIRLWSVEAGCQEIKKRLGNQKVFLVLDGVDKVAQVHALAKEKNWFGPGSRIIITTRDMGLLNTCGVEVVYEVKCLDDKDALQMFKQIAFEGGLPPCEGFDQLSIRASKLAHGLPSAIQAYALFLRGRTASPEEWEEALGALESSLDENIMEILKISYEGLPKPHQNVFLHVVCLFNGDTLQRITSLLHGPIPQSSLWIRVLAEKSLIKISTNGSVIMHKLVEQMGREIIRDDMSLARKFLRDPMEIRVALAFRDGGEQTECMCLHTCDMTCVLSMEASVVGRMHNLKFLKVYKHVDYRESNLQLIPDQPFLPRSLRLFHWDAFPLRALPSGSDPCFLVELNLRHSDLETLWSGTPSNGVKTENPCEKHNSNYFHVLLYLAQMLKSLKRLDVTGSKHLKQLPDLSSITSLEELLLEQCTRLEGIPECIGKRSTLKKLKLSYRGGRRSALRFFLRKSTRQQHIGLEFPDAKVKMDALINISIGGDITFEFRSKFRGYAEYVSFNSEQQIPIISAMSLQQAPWVISECNRFNSLRIMRFSHKENGESFSFDVFPDFPDLKELKLVNLNIRKIPSGICHLDLLEKLDLSGNDFENLPEAMSSLSRLKTLWLQNCFKLQELPKLTQVQTLTLTNCRNLRSLAKLSNTSQDEGRYCLLELCLENCKSVESLSDQLSHFTKLTCLDLSNHDFETLPSSIRDLTSLVTLCLNNCKKLKSVEKLPLSLQFLDAHGCDSLE

HMMPanther: PTHR23155:SF344
23-999 SUBFAMILY NOT NAMED

TRKTIVSHLYAALDSRGIVTFKDDQRLEIGDHISDELHRALGSSSFAVVVLSENYATSRWCLLELQLIMELMKEGRLEVFPIFYGVDPSVVRHQLGSFSLVKYQGLEMVDKVLRWREALNLIANLSGVVSSHCVDEAIMVGEIARDISRRVTLMHKIDSGNIVGMKAHMEGLNHLLDQESNEVLLVGIWGMGGIGKTSIVKCLYDQLSPKFPAHCFIENIKSVSKDNGHDLKHLQKELLSSILCDDIRLWSVEAGCQEIKKRLGNQKVFLVLDGVDKVAQVHALAKEKNWFGPGSRIIITTRDMGLLNTCGVEVVYEVKCLDDKDALQMFKQIAFEGGLPPCEGFDQLSIRASKLAHGLPSAIQAYALFLRGRTASPEEWEEALGALESSLDENIMEILKISYEGLPKPHQNVFLHVVCLFNGDTLQRITSLLHGPIPQSSLWIRVLAEKSLIKISTNGSVIMHKLVEQMGREIIRDDMSLARKFLRDPMEIRVALAFRDGGEQTECMCLHTCDMTCVLSMEASVVGRMHNLKFLKVYKHVDYRESNLQLIPDQPFLPRSLRLFHWDAFPLRALPSGSDPCFLVELNLRHSDLETLWSGTPSNGVKTENPCEKHNSNYFHVLLYLAQMLKSLKRLDVTGSKHLKQLPDLSSITSLEELLLEQCTRLEGIPECIGKRSTLKKLKLSYRGGRRSALRFFLRKSTRQQHIGLEFPDAKVKMDALINISIGGDITFEFRSKFRGYAEYVSFNSEQQIPIISAMSLQQAPWVISECNRFNSLRIMRFSHKENGESFSFDVFPDFPDLKELKLVNLNIRKIPSGICHLDLLEKLDLSGNDFENLPEAMSSLSRLKTLWLQNCFKLQELPKLTQVQTLTLTNCRNLRSLAKLSNTSQDEGRYCLLELCLENCKSVESLSDQLSHFTKLTCLDLSNHDFETLPSSIRDLTSLVTLCLNNCKKLKSVEKLPLSLQFLDAHGCDSLE

superfamily: SSF52540
167-417 P-loop containing nucleoside triphosphate hydrolases

RDISRRVTLMHKIDSGNIVGMKAHMEGLNHLLDQESNEVLLVGIWGMGGIGKTSIVKCLYDQLSPKFPAHCFIENIKSVSKDNGHDLKHLQKELLSSILCDDIRLWSVEAGCQEIKKRLGNQKVFLVLDGVDKVAQVHALAKEKNWFGPGSRIIITTRDMGLLNTCGVEVVYEVKCLDDKDALQMFKQIAFEGGLPPCEGFDQLSIRASKLAHGLPSAIQAYALFLRGRTASPEEWEEALGALESSLDENI

Gene3D: G3DSA:3.40.50.300
177-329 no description

HKIDSGNIVGMKAHMEGLNHLLDQESNEVLLVGIWGMGGIGKTSIVKCLYDQLSPKFPAHCFIENIKSVSKDNGHDLKHLQKELLSSILCDDIRLWSVEAGCQEIKKRLGNQKVFLVLDGVDKVAQVHALAKEKNWFGPGSRIIITTRDMGLL

HMMPfam: PF00931
IPR002182
188-445 NB-ARC,NBS
NB-ARC

KAHMEGLNHLLDQESNEVLLVGIWGMGGIGKTSIVKCLYDQLSPKFPAHCFIENIKSVSKDNGHDLKHLQKELLSSILCDDIRLWSVEAGCQEIKKRLGNQKVFLVLDGVDKVAQVHALAKEKNWFGPGSRIIITTRDMGLLNTCGVEVVYEVKCLDDKDALQMFKQIAFEGGLPPCEGFDQLSIRASKLAHGLPSAIQAYALFLRGRTASPEEWEEALGALESSLDENIMEILKISYEGLPKPHQNVFLHVVCLFNG

FPrintScan: PR00364
IPR000767
207-222 DISEASERSIST
Disease resistance protein

LVGIWGMGGIGKTSIV

FPrintScan: PR00364
IPR000767
284-298 DISEASERSIST
Disease resistance protein

RLGNQKVFLVLDGVD

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

AHGLPSAIQAYALFL

superfamily: SSF52058
484-996 L domain-like,LRR

IMHKLVEQMGREIIRDDMSLARKFLRDPMEIRVALAFRDGGEQTECMCLHTCDMTCVLSMEASVVGRMHNLKFLKVYKHVDYRESNLQLIPDQPFLPRSLRLFHWDAFPLRALPSGSDPCFLVELNLRHSDLETLWSGTPSNGVKTENPCEKHNSNYFHVLLYLAQMLKSLKRLDVTGSKHLKQLPDLSSITSLEELLLEQCTRLEGIPECIGKRSTLKKLKLSYRGGRRSALRFFLRKSTRQQHIGLEFPDAKVKMDALINISIGGDITFEFRSKFRGYAEYVSFNSEQQIPIISAMSLQQAPWVISECNRFNSLRIMRFSHKENGESFSFDVFPDFPDLKELKLVNLNIRKIPSGICHLDLLEKLDLSGNDFENLPEAMSSLSRLKTLWLQNCFKLQELPKLTQVQTLTLTNCRNLRSLAKLSNTSQDEGRYCLLELCLENCKSVESLSDQLSHFTKLTCLDLSNHDFETLPSSIRDLTSLVTLCLNNCKKLKSVEKLPLSLQFLDAHGCD

HMMPfam: PF07725
IPR011713
604-622 LRR_3
Leucine-rich repeat 3

FLVELNLRHSDLETLWSGT

Seg: seg
671-683 seg

LSSITSLEELLLE

Gene3D: G3DSA:3.80.10.10
807-984 no description

KENGESFSFDVFPDFPDLKELKLVNLNIRKIPSGICHLDLLEKLDLSGNDFENLPEAMSSLSRLKTLWLQNCFKLQELPKLTQVQTLTLTNCRNLRSLAKLSNTSQDEGRYCLLELCLENCKSVESLSDQLSHFTKLTCLDLSNHDFETLPSSIRDLTSLVTLCLNNCKKLKSVEKLP

Seg: seg
812-823 seg

SFSFDVFPDFPD

HMMPfam: PF12799
847-887 LRR_4,Leucine Rich repeats (2 copies)

LEKLDLSGNDFENLPEAMSSLSRLKTLWLQNCFKLQELPKL

FPrintScan: PR00364
IPR000767
961-977 DISEASERSIST
Disease resistance protein

RDLTSLVTLCLNNCKKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox