PRGDB00047086 (disease resistance protein (TIR-NBS class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145337464 (NM_105945)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS class), putative (AT1G72870) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCTTCCTCCTCATCAGAGCATAAAGTGTTCCTGAGTTTTAGAAGAGAGGACACCGGTAGAACTTTTGTCAGCCATCTATACCGTTCGTTGGATCAAAAAGAAATTCGAACTTACAAATTTGAAAACCAGCAGGCGGGAGACGGAAAGAGGATATCTTCTGAGGTCAAGCAGGCTATCAACGAGTCTAGGATTGCTGTCGTTGTGATATCGGAGAACTACGTCTCTTCCGTCTTGTGCTTGGACGTACTCGCGAAGATAATTGAGCGTTTGCCTCTCATCAAAATCGAAACAGTCTTCTACGAAGTGGATCCGGGGGATTTGACAAGACCAACTGGTAAATTCGCCGACGACTTCAGGAGGCATGAAGCGAGAGAAAATCGGAGAACCGTGAATCGTTGGAGGGATGCACTGGACCAATTGGTTAGCATCACCAACAGTAATTTTTGTTCGCGCAATTGGGAGGATGATTCCAAGATGATCGATGATCTAATCATCAGACTAATCAATATTTATTTTTCTAAATACTACACACCGGACGTAGATATAATCGCAGAAACGACAGTTGGCCTAGACGCGAGCGTTCTGGGATTGATGACAGATATCGATATGAAGTACAAACTCAACAGTCTGTCTGGGTCTGTAGAATCTGGATTTGGACTTGAGAGATATGCACTTGAAGCCACATCTGTTATGGACGATATGTCAAATGAATCGCCTTCTCCCACATCTGACGACTCCAACGGTCTTGTTGGGATGTATCGTCATAAGAAAGCGGTCTATGGATTGCTTGATTTGGAATCTAAGAACCAGGTCCGTACAATTGGCATTTGGGGTTTCCAAGGCGTCGGGAAAACGACACTTGCTGAATGTGTTTTCGACGACATCTCAAGCCACTTTCAACACTACTGCTTCCTAACCAATGCCAATAAAATCTATCAGAACCGCATCTCACCAAGTTTACTAAAACATCTTACAAGGAGAAGGAGTTCTGAAGACATATTTGATGCCATCAAACCAAGTCTTGTAAACCGAAAAGTCCTGTTTGTTGTTGATGGTGTTGATGCTACTTACAATGAACAATTTAACGATGCCATGAAGGTTACCCGTTGGCTCGGTCCTGGCAGTAGAATTATCATGACATCTAGATTCAAGTCTTCGCTTAAGTTCGGTGGGGCAAAATACGAGATGGAGTGTCTGAGATATGAGGAAGCTCTACAACTCTTCTCTCTATACGCTTTCAAGAAAACTTACCCTCTTATTGGTTTTGAACTATTCTCCATTCGTGCTGTCCACTTTGCTGGACGTCTTCCTCTGTCCCTGAAAGTACTCGGTTCATTTCTATATGATAAAGACGAAGAGAGTTGGAAAAGAACATTGCACAAGCTAGAAGCATCACAAGATAACGATCGTCGTTATGTCTCTAACTACATCGGGGCAGGTGAATACCTTCCAAGACGTCAAATAGAATTGGAACAATATGTAAGTCCAGATGAAGAAGAATATTCACCTTCATATATCATGTCACTTTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS class), putative disease resistance protein (TIR-NBS class), putative [Arabidopsis thaliana].

MASSSSSSEHKVFLSFRREDTGRTFVSHLYRSLDQKEIRTYKFENQQAGDGKRISSEVKQAINESRIAVVVISENYVSSVLCLDVLAKIIERLPLIKIETVFYEVDPGDLTRPTGKFADDFRRHEARENRRTVNRWRDALDQLVSITNSNFCSRNWEDDSKMIDDLIIRLINIYFSKYYTPDVDIIAETTVGLDASVLGLMTDIDMKYKLNSLSGSVESGFGLERYALEATSVMDDMSNESPSPTSDDSNGLVGMYRHKKAVYGLLDLESKNQVRTIGIWGFQGVGKTTLAECVFDDISSHFQHYCFLTNANKIYQNRISPSLLKHLTRRRSSEDIFDAIKPSLVNRKVLFVVDGVDATYNEQFNDAMKVTRWLGPGSRIIMTSRFKSSLKFGGAKYEMECLRYEEALQLFSLYAFKKTYPLIGFELFSIRAVHFAGRLPLSLKVLGSFLYDKDEESWKRTLHKLEASQDNDRRYVSNYIGAGEYLPRRQIELEQYVSPDEEEYSPSYIMSL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ASSSSSSEHKVFLSFRREDTGRTFVSHLYRSLDQKEIRTYKFENQQAGDGKRISSEVKQAINESRIAVVVISENYVSSVLCLDVLAKIIERLPLIKIETVFYEVDPGDLTRPTGKFADDFRRHEARENRRTVNRWRDALDQLVSITNS

Gene3D: G3DSA:3.40.50.10140
6-144 G3DSA:3.40.50.10140

SSSEHKVFLSFRREDTGRTFVSHLYRSLDQKEIRTYKFENQQAGDGKRISSEVKQAINESRIAVVVISENYVSSVLCLDVLAKIIERLPLIKIETVFYEVDPGDLTRPTGKFADDFRRHEARENRRTVNRWRDALDQLV

ProfileScan: PS50104
IPR000157
8-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SEHKVFLSFRREDTGRTFVSHLYRSLDQKEIRTYKFENQQAGDGKRISSEVKQAINESRIAVVVISENYVSSVLCLDVLAKIIERLPLIKIETVFYEVDPGDLTRPTGKFADDFRRHEARENRRTVNRWRDALDQLVSI

HMMSmart: SM00255
IPR000157
9-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EHKVFLSFRREDTGRTFVSHLYRSLDQKEIRTYKFENQQAGDGKRISSEVKQAINESRIAVVVISENYVSSVLCLDVLAKIIERLPLIKIETVFYEVDPGDLTRPTGKFADDFRRHEARENRRTVNRWRDALDQLVSI

HMMPfam: PF01582
IPR000157
12-141 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRREDTGRTFVSHLYRSLDQKEIRTYKFENQQAGDGKRISSEVKQAINESRIAVVVISENYVSSVLCLDVLAKIIERLPLIKIETVFYEVDPGDLTRPTGKFADDFRRHEARENRRTVNRWRDALD

HMMPanther: PTHR11017
102-472 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FYEVDPGDLTRPTGKFADDFRRHEARENRRTVNRWRDALDQLVSITNSNFCSRNWEDDSKMIDDLIIRLINIYFSKYYTPDVDIIAETTVGLDASVLGLMTDIDMKYKLNSLSGSVESGFGLERYALEATSVMDDMSNESPSPTSDDSNGLVGMYRHKKAVYGLLDLESKNQVRTIGIWGFQGVGKTTLAECVFDDISSHFQHYCFLTNANKIYQNRISPSLLKHLTRRRSSEDIFDAIKPSLVNRKVLFVVDGVDATYNEQFNDAMKVTRWLGPGSRIIMTSRFKSSLKFGGAKYEMECLRYEEALQLFSLYAFKKTYPLIGFELFSIRAVHFAGRLPLSLKVLGSFLYDKDEESWKRTLHKLEASQDND

HMMPanther: PTHR11017:SF20
102-472 PTHR11017:SF20,SUBFAMILY NOT NAMED

FYEVDPGDLTRPTGKFADDFRRHEARENRRTVNRWRDALDQLVSITNSNFCSRNWEDDSKMIDDLIIRLINIYFSKYYTPDVDIIAETTVGLDASVLGLMTDIDMKYKLNSLSGSVESGFGLERYALEATSVMDDMSNESPSPTSDDSNGLVGMYRHKKAVYGLLDLESKNQVRTIGIWGFQGVGKTTLAECVFDDISSHFQHYCFLTNANKIYQNRISPSLLKHLTRRRSSEDIFDAIKPSLVNRKVLFVVDGVDATYNEQFNDAMKVTRWLGPGSRIIMTSRFKSSLKFGGAKYEMECLRYEEALQLFSLYAFKKTYPLIGFELFSIRAVHFAGRLPLSLKVLGSFLYDKDEESWKRTLHKLEASQDND

superfamily: SSF52540
235-465 SSF52540

DDMSNESPSPTSDDSNGLVGMYRHKKAVYGLLDLESKNQVRTIGIWGFQGVGKTTLAECVFDDISSHFQHYCFLTNANKIYQNRISPSLLKHLTRRRSSEDIFDAIKPSLVNRKVLFVVDGVDATYNEQFNDAMKVTRWLGPGSRIIMTSRFKSSLKFGGAKYEMECLRYEEALQLFSLYAFKKTYPLIGFELFSIRAVHFAGRLPLSLKVLGSFLYDKDEESWKRTLHKL

HMMPfam: PF00931
IPR002182
258-474 NB-ARC,NBS
NB-ARC

HKKAVYGLLDLESKNQVRTIGIWGFQGVGKTTLAECVFDDISSHFQHYCFLTNANKIYQNRISPSLLKHLTRRRSSEDIFDAIKPSLVNRKVLFVVDGVDATYNEQFNDAMKVTRWLGPGSRIIMTSRFKSSLKFGGAKYEMECLRYEEALQLFSLYAFKKTYPLIGFELFSIRAVHFAGRLPLSLKVLGSFLYDKDEESWKRTLHKLEASQDNDRR

Gene3D: G3DSA:3.40.50.300
275-310 G3DSA:3.40.50.300

RTIGIWGFQGVGKTTLAECVFDDISSHFQHYCFLTN

FPrintScan: PR00364
IPR000767
276-291 DISEASERSIST
Disease resistance protein

TIGIWGFQGVGKTTLA

FPrintScan: PR00364
IPR000767
343-357 DISEASERSIST
Disease resistance protein

SLVNRKVLFVVDGVD

FPrintScan: PR00364
IPR000767
436-450 DISEASERSIST
Disease resistance protein

AGRLPLSLKVLGSFL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox