PRGDB00047088 (RGA5)

From PRG Wiki
Jump to: navigation, search
RGA5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 66271015 (DQ018369)
Gene Class NL
Domain Type NBS, LRR
Gene Species (Populus tomentosa x P. bolleana) x P. tomentosa var. truncata

Comment?

(Populus tomentosa x P. bolleana) x P. tomentosa var. truncata NBS-LRR type disease resistance protein (RGA5) gene, partial cds.

DNA Sequence

GGGATGGGTGGGTTCGGGAAGACGACATTGCTCACACATATCTACAATCAGCTTCTACAAGAACCTGGCACTTTTCGTCATGTTTACTGGATCACGTTATCGCAGGATTTTAGTGTTTATAGATTGCAGAATATTATTGCAAAACACATTCATTTAGATCTTTCAAATGAAGACAACGAGAGGAAAAGGGCCGCAAAACTGTCAAAAGCATTAATTGGGAAACAACGGTGGGTTCTCATTTTGGATGATTTGTGGAACTGTTTTGATTTTGATAAGGTGGGAATTCCTATCCAAGTGAAGGGATGCAAACTAATTGTTACAACTCGATCATTTGAAGTTTGTAAGCGGATGGCCTTCCACTTGCCCTCAAAGTC


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [(Populus tomentosa x P. bolleana) x P. tomentosa var. truncata].

GMGGFGKTTLLTHIYNQLLQEPGTFRHVYWITLSQDFSVYRLQNIIAKHIHLDLSNEDNERKRAAKLSKALIGKQRWVLILDDLWNCFDFDKVGIPIQVKGCKLIVTTRSFEVCKRMAFHLPSKS


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-118 NB-ARC,NBS
NB-ARC

GMGGFGKTTLLTHIYNQLLQEPGTFRHVYWITLSQDFSVYRLQNIIAKHIHLDLSNEDNERKRAAKLSKALIGKQRWVLILDDLWNCFDFDKVGIPIQVKGCKLIVTTRSFEVCKRMA

HMMPanther: PTHR23155
1-98 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGFGKTTLLTHIYNQLLQEPGTFRHVYWITLSQDFSVYRLQNIIAKHIHLDLSNEDNERKRAAKLSKALIGKQRWVLILDDLWNCFDFDKVGIPIQ

superfamily: SSF52540
1-118 SSF52540

GMGGFGKTTLLTHIYNQLLQEPGTFRHVYWITLSQDFSVYRLQNIIAKHIHLDLSNEDNERKRAAKLSKALIGKQRWVLILDDLWNCFDFDKVGIPIQVKGCKLIVTTRSFEVCKRMA

HMMPanther: PTHR23155:SF108
1-98 PTHR23155:SF108,SUBFAMILY NOT NAMED

GMGGFGKTTLLTHIYNQLLQEPGTFRHVYWITLSQDFSVYRLQNIIAKHIHLDLSNEDNERKRAAKLSKALIGKQRWVLILDDLWNCFDFDKVGIPIQ

Gene3D: G3DSA:3.40.50.300
1-87 G3DSA:3.40.50.300

GMGGFGKTTLLTHIYNQLLQEPGTFRHVYWITLSQDFSVYRLQNIIAKHIHLDLSNEDNERKRAAKLSKALIGKQRWVLILDDLWNC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox