PRGDB00047098 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 85541774 (DQ341405)
Gene Class NL
Domain Type NBS, LRR
Gene Species Ipomoea batatas

Comment?

Ipomoea batatas clone SPRGA-11 putative disease resistance protein gene, partial cds.

DNA Sequence

GGGGGCGTTGGTAAGACCACATTGGCTAAGAGTGTTTATGTAGATCAGTCAATTGTATCCTATTTTGACAAGCGAGCTTGGGTTGTTGTATCCCAACATCATAATAAGAGACAAATGCTCACGGGTCTTCTTAAATCAATGGGCTGTGCAAATAGTGGCACCCAAGAGGAGCTGGCAGAACAACTATATCGATATTTGCTGCATCAAAGGTACTTTGTTGTGATAGATGACATTTGGAGTGAAGAGGCGTGGAATGCTCGCAAAGCTTCTTTCCAGATAATAGCAATCATAGCCGAGTATTGTTATCTACTCGCTTTGCAAAGGTATCTACTCGTATTGGCTCTAGTAATGACTTTTCTCATCAAATGCAATTATTACATGAAAGTGAGAGTTGGAATTTATTTCACGAAAAGACATGCAAATCTTGGGATGTTGAATTTGAGGCAATTGTATGACTACTTGTTAAGAAATGCAAAGGACTTCCTCTGGCTGC


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Ipomoea batatas].

GGVGKTTLAKSVYVDQSIVSYFDKRAWVVVSQHHNKRQMLTGLLKSMGCANSGTQEELAEQLYRYLLHQRYFVVIDDIWSEEAWNARKASFQIIAIIAEYCYLLALQRYLLVLALVMTFLIKCNYYMKVRVGIYFTKRHANLGMLNLRQLYDYLLRNAKDFLWL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
1-85 PTHR23155:SF121,SUBFAMILY NOT NAMED

GGVGKTTLAKSVYVDQSIVSYFDKRAWVVVSQHHNKRQMLTGLLKSMGCANSGTQEELAEQLYRYLLHQRYFVVIDDIWSEEAWN

superfamily: SSF52540
1-86 SSF52540

GGVGKTTLAKSVYVDQSIVSYFDKRAWVVVSQHHNKRQMLTGLLKSMGCANSGTQEELAEQLYRYLLHQRYFVVIDDIWSEEAWNA

HMMPanther: PTHR23155
1-85 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLAKSVYVDQSIVSYFDKRAWVVVSQHHNKRQMLTGLLKSMGCANSGTQEELAEQLYRYLLHQRYFVVIDDIWSEEAWN

HMMPfam: PF00931
IPR002182
1-91 NB-ARC,NBS
NB-ARC

GGVGKTTLAKSVYVDQSIVSYFDKRAWVVVSQHHNKRQMLTGLLKSMGCANSGTQEELAEQLYRYLLHQRYFVVIDDIWSEEAWNARKASF


List of References

Guanshui Chen, Daren Pan, Yifei Zhou, Sheng Lin, Xiangde Ke
Diversity and evolutionary relationship of nucleotide binding site-encoding disease-resistance gene analogues in sweet potato (Ipomoea batatas Lam.).
J. Biosci.: 2007, 32(4);713-21
PubMed:17762144 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox