PRGDB00047099 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 85541772 (DQ341404)
Gene Class Unknown
Domain Type
Gene Species Ipomoea batatas

Comment?

Ipomoea batatas clone SPRGA-10 putative disease resistance protein gene, partial cds.

DNA Sequence

GTAGTAGCAGATGCCTTATCACGGAGGAACCAGGATACAGCAGAGTGTTTCACAATATCCTTGTTGCGTTCAAAGTTATTAGAGGATATTAAAATTGCTGTACGCGACTCAGAGGAGTACAAGCCGTTCATCCAAAACTGTGACCATCAGAAGGAGGAAATGTGGTTCTTGAAAGAAGGATTGGTTTTTTATAGAGGGAAAATCTTTATTCCCCCACACTCAGACCTCCCTCTGCGAATTTTGCAGGAAATCCACAGCTCCAACCATGAAGGGGTGCAGAAAACGATCCACCGTGTCCGCAGAGACTTTTATTGGCCAGGGTTGAATAAAATGGTCCGCGAATTCGTTTCTAATTGCTCCACTTGCCAGCAACAAAAATGGGAAAATCTCCGACCCGCGGGGCTGCTCCAACCACTCCCAATCCCTCACCAAATATGGGCTGATGTCTCACTTGATTTTGTGGAGGGGCTGCCTCTGGTTGC


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Ipomoea batatas].

VVADALSRRNQDTAECFTISLLRSKLLEDIKIAVRDSEEYKPFIQNCDHQKEEMWFLKEGLVFYRGKIFIPPHSDLPLRILQEIHSSNHEGVQKTIHRVRRDFYWPGLNKMVREFVSNCSTCQQQKWENLRPAGLLQPLPIPHQIWADVSLDFVEGLPLVA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10178
1-158 PTHR10178,GAG/POL/ENV POLYPROTEIN

VVADALSRRNQDTAECFTISLLRSKLLEDIKIAVRDSEEYKPFIQNCDHQKEEMWFLKEGLVFYRGKIFIPPHSDLPLRILQEIHSSNHEGVQKTIHRVRRDFYWPGLNKMVREFVSNCSTCQQQKWENLRPAGLLQPLPIPHQIWADVSLDFVEGLP

HMMPanther: PTHR10178:SF14
1-158 PTHR10178:SF14,RETROVIRUS POLYPROTEIN

VVADALSRRNQDTAECFTISLLRSKLLEDIKIAVRDSEEYKPFIQNCDHQKEEMWFLKEGLVFYRGKIFIPPHSDLPLRILQEIHSSNHEGVQKTIHRVRRDFYWPGLNKMVREFVSNCSTCQQQKWENLRPAGLLQPLPIPHQIWADVSLDFVEGLP

HMMPfam: PF09337
IPR015416
85-123 zf-H2C2
Zinc finger, H2C2-type, histone UAS binding

HSSNHEGVQKTIHRVRRDFYWPGLNKMVREFVSNCSTCQ


List of References

Guanshui Chen, Daren Pan, Yifei Zhou, Sheng Lin, Xiangde Ke
Diversity and evolutionary relationship of nucleotide binding site-encoding disease-resistance gene analogues in sweet potato (Ipomoea batatas Lam.).
J. Biosci.: 2007, 32(4);713-21
PubMed:17762144 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox