PRGDB00047103 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186479098 (NM_001123924)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT1G31540) mRNA, complete cds.

DNA Sequence

ATGGCTTCGTCATCTTCTTCTCACAATTGGTTATATGATGTTTTCTTGAGCTTCAGAGGGGAAGACGTCCGCGTAACATTCCGTAGCCACTTTCTCAAAGAGCTTGATCGGAAACTAATCACTGCTTTCAGAGACAATGAGATCGAGAGAAGCCACTCTCTCTGGCCCGATCTTGAACAAGCCATCAAGGAATCCAGGATCGCTGTGGTCGTTTTCTCAAAAAACTACGCTTCATCGAGCTGGTGTCTTAACGAGTTGCTGGAGATTGTAAACTGCAATGATAAAATTGTCATACCAGTTTTCTACCATGTGGATCCTTCCCAAGTGAGGCATCAAATCGGCGACTTCGGAAAGATCTTTGAAAATACTTGCAAGAGACAAACAGATGAGGAAGTGAAAAATCAATGGAAGAAAGCGTTGACTCTTGTAGCGAATATGCTTGGATTTGACTCTGCCAAATGGAACGACGAAGCAAAAATGATTGAAGAAATAGCCAATGATGTTTTGGGTAAACTGCTTTTAACTACACCCAAGGATTCTGAGGAACTTGTTGGCATCGAAGATCACATCGCTGAAATGAGTTTACTGCTGCAACTGGAATCTAAAGAAGTGAGAATGGTTGGTATATCGGGTTCCTCAGGGATTGGTAAGACTACCATTGCAAGAGCTCTGTTTAAACGACTTTCTCGACATTTCCAAGGTAGCACTTTCATCGACAGGGCTTTTGTATCTTATAGTCGGAATATTTATAGTGGCGCCAATCCGGACGACCCCAATATGAAGTTGCAGCTACAAGGACACTTCCTATCTGAAATTCTCGGGAAAAAAGACATAAAGATAGATGATCCAGCTGCATTGGAAGAGAGGCTAAAGCACCAAAAAGTTCTTATCATTATTGATGATTTGGATGATATAATGGTACTAGATACATTAGTGGGTCAAACTCAATGGTTTGGATATGGGAGCAGAATCATTGTGGTTACAAATGATAAGCACTTCTTGATTGCTCATGGAATTGATCATATTTATGAAGTAAGTTTCCCAACTGATGTGCATGCTTGTCAGATGTTATGTCAATCTGCATTCAAGCAAAACTATGCTCCTAAAGGTTTTGAGGATCTTGTAGTTGATGTAGTAAGACATGCGGGCAATTTTCCTTTGGGTCTTAATCTTTTGGGTAAATATTTGCGGAGGAGGGATATGGAATACTGGATGGATATGCTGCCAAGGCTTGAGAATAGTCTACGTATAGACGGTAAAATTGAAAAAATACTAAGAATCAGCTATGATGGGTTAGAGAGTGAAGATCAAGAGATATTTCGTCATATCGCATGTCTTTTCAATCATATGGAAGTCACAACCATCAAGTCCTTGCTGGCAGATAGTGATGTTAGTTTTGCACTAGAAAACCTAGCTGATAAGTCCCTCATTCATGTCAGACAAGGTTATGTGGTGATGCACCGTTCGCTACAAGAAATGGGTAGAAAAATTGTTCGCATTCAGTCCATTGACAAACCTGGAGAACGAGAATTTCTGGTGGATCCAAATGATATACATGATATACTCAATGCATGCACTGGTACTCAAAAGGTTTTAGGTATATCACTGGATATAAGGAATATTCGTGAGTTGGATGTACATGAGAGGGCCTTCAAAGGGATGTCTAATCTCCGTTTCTTAGAAATTAAGAACTTTGGTTTGAAAGAAGACGGTTTGCATTTACCTCCAAGTTTCGACTATTTGCCCCGTACACTCAAACTATTGTGCTGGTCCAAATTTCCAATGAGGTGTATGCCTTTTGGTTTTCGTCCTGAAAACCTTGTCAAGCTCGAAATGCAGTACAGCAAGCTACATAAGCTATGGGAAGGAGTTGCGCCACTTACATGTCTAAAGGAAATGGATCTGCACGGATCATCAAACCTGAAAGTAATTCCAGATCTTTCTGAAGCTACTAATCTCGAGATACTTAATCTTAAGTTTTGCGAGAGTTTGGTCGAGCTCCCGTCCTCTATACGAAATCTCAATAAACTGTTGAACTTGGACATGCTAAACTGCAAAAGTCTGAAAATTCTTCCTACCGGATTCAACCTCAAATCTCTTGACCGCCTCAATCTCTATCATTGCTCAAAGTTGAAGACTTTTCCCAAATTCTCAACCAACATCTCAGTTCTCAATCTAAATCTAACAAACATTGAAGATTTCCCTTCTAATTTACATCTCGAGAATCTTGTTGAGTTTAGAATATCAAAAGAAGAGAGTGATGAGAAACAATGGGAAGAAGAGAAGCCGCTTACGCCCTTCCTGGCGATGATGTTGTCTCCCACTTTGACGAGCTTGCATCTCGAGAATCTCCCAAGTTTGGTGGAGCTTACTTCCTCATTTCAGAATCTCAATCAACTGAAGGACTTGATCATAATAAACTGCATAAATCTGGAGACTCTGCCCACCGGAATCAACCTCCAATCTCTTGATTACCTTTGTTTCAGTGGATGCTCACAGTTGAGGAGCTTTCCTGAAATCTCAACCAACATCTCAGTGCTCTATCTAGACGAAACAGCGATTGAAGAGGTTCCTTGGTGGATCGAGAAATTCTCTAACCTCACTGAGCTAAGCATGAACAGTTGCAGCAGGCTAAAATGTGTGTTCCTACACATGTCTAAACTGAAACATCTTAAGGAAGCTTTGTTTCGAAATTGTGGTACATTGACCAGAGTTGAATTGAGTGGATATCCAAGTGGGATGGAGGTGATGAAAGCAGACAATATTGACACAGCCTCCTCTTCTCTTCCTAAAGTCGTACTCAGTTTCTTGGACTGCTTCAACTTGGATCCAGAAACTGTCCTTCATCACCAAGAATCAATTATTTTCAACTACATGTTATTTACAGGGAAAGAAGAAGTGCCATCATATTTCACTTACCGTACTACTGGAAGCTCCTCTCTGACCATTCCTATACTTCACGTCCATCTCTCCCAACCATTCTTCAGATTTAGGATTGGCGCATTGGTAACTAATAAGGAGGAGCCAGTAGAGCTCGAGGTAAAATGTGAGTTCAAAGACAGATTTGGGAACAACTTTGATTATGACATTTATTTCGAAGTTAATAAAGATAGATATTATGGGGAGGATTGCTATAATATAGCTATATTGGACTGTCGTATCCCTCTAAACGAAGATAATGCTGCTCTAGCTCAACGGAACTACTACGATCATGTGGATATAAAGATTGAGCAATTAGACAAAAGATATAGTGATATTGAACAATGGGGTATACGACTCTTAGAGGACTGTTCATCAGCGGAGACTCGACTTGATAATTATTCAAACAGTACTCTTCCACATGTTTCTGAAGCCGAAGAAGGTAATAAAGGGTATACACCTCTTCAAGGACTTGTTAATGAGATTGAACACAGTGAAGAGCCTGGAGATATCAATGTAGAAACTGAGAGAAGCACGAAGCGCATGCGGCTATATCACTTCATATAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSSSHNWLYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANMLGFDSAKWNDEAKMIEEIANDVLGKLLLTTPKDSEELVGIEDHIAEMSLLLQLESKEVRMVGISGSSGIGKTTIARALFKRLSRHFQGSTFIDRAFVSYSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLIAHGIDHIYEVSFPTDVHACQMLCQSAFKQNYAPKGFEDLVVDVVRHAGNFPLGLNLLGKYLRRRDMEYWMDMLPRLENSLRIDGKIEKILRISYDGLESEDQEIFRHIACLFNHMEVTTIKSLLADSDVSFALENLADKSLIHVRQGYVVMHRSLQEMGRKIVRIQSIDKPGEREFLVDPNDIHDILNACTGTQKVLGISLDIRNIRELDVHERAFKGMSNLRFLEIKNFGLKEDGLHLPPSFDYLPRTLKLLCWSKFPMRCMPFGFRPENLVKLEMQYSKLHKLWEGVAPLTCLKEMDLHGSSNLKVIPDLSEATNLEILNLKFCESLVELPSSIRNLNKLLNLDMLNCKSLKILPTGFNLKSLDRLNLYHCSKLKTFPKFSTNISVLNLNLTNIEDFPSNLHLENLVEFRISKEESDEKQWEEEKPLTPFLAMMLSPTLTSLHLENLPSLVELTSSFQNLNQLKDLIIINCINLETLPTGINLQSLDYLCFSGCSQLRSFPEISTNISVLYLDETAIEEVPWWIEKFSNLTELSMNSCSRLKCVFLHMSKLKHLKEALFRNCGTLTRVELSGYPSGMEVMKADNIDTASSSLPKVVLSFLDCFNLDPETVLHHQESIIFNYMLFTGKEEVPSYFTYRTTGSSSLTIPILHVHLSQPFFRFRIGALVTNKEEPVELEVKCEFKDRFGNNFDYDIYFEVNKDRYYGEDCYNIAILDCRIPLNEDNAALAQRNYYDHVDIKIEQLDKRYSDIEQWGIRLLEDCSSAETRLDNYSNSTLPHVSEAEEGNKGYTPLQGLVNEIEHSEEPGDINVETERSTKRMRLYHFI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSSHNWLYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANMLGF

Gene3D: G3DSA:3.40.50.10140
8-140 G3DSA:3.40.50.10140

HNWLYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKAL

ProfileScan: PS50104
IPR000157
10-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WLYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANM

HMMSmart: SM00255
IPR000157
11-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANM

HMMPfam: PF01582
IPR000157
14-140 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKAL

HMMPanther: PTHR11017
32-1156 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANMLGFDSAKWNDEAKMIEEIANDVLGKLLLTTPKDSEELVGIEDHIAEMSLLLQLESKEVRMVGISGSSGIGKTTIARALFKRLSRHFQGSTFIDRAFVSYSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLIAHGIDHIYEVSFPTDVHACQMLCQSAFKQNYAPKGFEDLVVDVVRHAGNFPLGLNLLGKYLRRRDMEYWMDMLPRLENSLRIDGKIEKILRISYDGLESEDQEIFRHIACLFNHMEVTTIKSLLADSDVSFALENLADKSLIHVRQGYVVMHRSLQEMGRKIVRIQSIDKPGEREFLVDPNDIHDILNACTGTQKVLGISLDIRNIRELDVHERAFKGMSNLRFLEIKNFGLKEDGLHLPPSFDYLPRTLKLLCWSKFPMRCMPFGFRPENLVKLEMQYSKLHKLWEGVAPLTCLKEMDLHGSSNLKVIPDLSEATNLEILNLKFCESLVELPSSIRNLNKLLNLDMLNCKSLKILPTGFNLKSLDRLNLYHCSKLKTFPKFSTNISVLNLNLTNIEDFPSNLHLENLVEFRISKEESDEKQWEEEKPLTPFLAMMLSPTLTSLHLENLPSLVELTSSFQNLNQLKDLIIINCINLETLPTGINLQSLDYLCFSGCSQLRSFPEISTNISVLYLDETAIEEVPWWIEKFSNLTELSMNSCSRLKCVFLHMSKLKHLKEALFRNCGTLTRVELSGYPSGMEVMKADNIDTASSSLPKVVLSFLDCFNLDPETVLHHQESIIFNYMLFTGKEEVPSYFTYRTTGSSSLTIPILHVHLSQPFFRFRIGALVTNKEEPVELEVKCEFKDRFGNNFDYDIYFEVNKDRYYGEDCYNIAILDCRIPLNEDNAALAQRNYYDHVDIKIEQLDKRYSDIEQWGIRLLEDCSSAETRLDNYSNSTLPHVSEAEEGNKGYTPLQGLVNEIEHSEEPGDINVETERSTKRMR

HMMPanther: PTHR11017:SF20
32-1156 PTHR11017:SF20,SUBFAMILY NOT NAMED

LKELDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANMLGFDSAKWNDEAKMIEEIANDVLGKLLLTTPKDSEELVGIEDHIAEMSLLLQLESKEVRMVGISGSSGIGKTTIARALFKRLSRHFQGSTFIDRAFVSYSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLIAHGIDHIYEVSFPTDVHACQMLCQSAFKQNYAPKGFEDLVVDVVRHAGNFPLGLNLLGKYLRRRDMEYWMDMLPRLENSLRIDGKIEKILRISYDGLESEDQEIFRHIACLFNHMEVTTIKSLLADSDVSFALENLADKSLIHVRQGYVVMHRSLQEMGRKIVRIQSIDKPGEREFLVDPNDIHDILNACTGTQKVLGISLDIRNIRELDVHERAFKGMSNLRFLEIKNFGLKEDGLHLPPSFDYLPRTLKLLCWSKFPMRCMPFGFRPENLVKLEMQYSKLHKLWEGVAPLTCLKEMDLHGSSNLKVIPDLSEATNLEILNLKFCESLVELPSSIRNLNKLLNLDMLNCKSLKILPTGFNLKSLDRLNLYHCSKLKTFPKFSTNISVLNLNLTNIEDFPSNLHLENLVEFRISKEESDEKQWEEEKPLTPFLAMMLSPTLTSLHLENLPSLVELTSSFQNLNQLKDLIIINCINLETLPTGINLQSLDYLCFSGCSQLRSFPEISTNISVLYLDETAIEEVPWWIEKFSNLTELSMNSCSRLKCVFLHMSKLKHLKEALFRNCGTLTRVELSGYPSGMEVMKADNIDTASSSLPKVVLSFLDCFNLDPETVLHHQESIIFNYMLFTGKEEVPSYFTYRTTGSSSLTIPILHVHLSQPFFRFRIGALVTNKEEPVELEVKCEFKDRFGNNFDYDIYFEVNKDRYYGEDCYNIAILDCRIPLNEDNAALAQRNYYDHVDIKIEQLDKRYSDIEQWGIRLLEDCSSAETRLDNYSNSTLPHVSEAEEGNKGYTPLQGLVNEIEHSEEPGDINVETERSTKRMR

superfamily: SSF52540
65-441 SSF52540

SRIAVVVFSKNYASSSWCLNELLEIVNCNDKIVIPVFYHVDPSQVRHQIGDFGKIFENTCKRQTDEEVKNQWKKALTLVANMLGFDSAKWNDEAKMIEEIANDVLGKLLLTTPKDSEELVGIEDHIAEMSLLLQLESKEVRMVGISGSSGIGKTTIARALFKRLSRHFQGSTFIDRAFVSYSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLIAHGIDHIYEVSFPTDVHACQMLCQSAFKQNYAPKGFEDLVVDVVRHAGNFPLGLNLLGKYLRRRDMEYWMDMLPRLENSLRIDGKIEKILRISYDGLESEDQEIFR

HMMPfam: PF00931
IPR002182
187-454 NB-ARC,NBS
NB-ARC

EDHIAEMSLLLQLESKEVRMVGISGSSGIGKTTIARALFKRLSRHFQGSTFIDRAFVSYSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLIAHGIDHIYEVSFPTDVHACQMLCQSAFKQNYAPKGFEDLVVDVVRHAGNFPLGLNLLGKYLRRRDMEYWMDMLPRLENSLRIDGKIEKILRISYDGLESEDQEIFRHIACLFNHMEVTT

Gene3D: G3DSA:3.40.50.300
199-213 G3DSA:3.40.50.300

LESKEVRMVGISGSS

HMMSmart: SM00382
IPR003593
203-349 AAA,NBS
AAA+ ATPase domain

EVRMVGISGSSGIGKTTIARALFKRLSRHFQGSTFIDRAFVSYSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLIAHGIDHIYEVSFPT

FPrintScan: PR00364
IPR000767
206-221 DISEASERSIST
Disease resistance protein

MVGISGSSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
214-357 G3DSA:3.40.50.300

GIGKTTIARALFKRLSRHFQGSTFIDRAFVSYSRNIYSGANPDDPNMKLQLQGHFLSEILGKKDIKIDDPAALEERLKHQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLIAHGIDHIYEVSFPTDVHACQML

FPrintScan: PR00364
IPR000767
289-303 DISEASERSIST
Disease resistance protein

RLKHQKVLIIIDDLD

FPrintScan: PR00364
IPR000767
382-396 DISEASERSIST
Disease resistance protein

AGNFPLGLNLLGKYL

superfamily: SSF46785
419-523 SSF46785

GKIEKILRISYDGLESEDQEIFRHIACLFNHMEVTTIKSLLADSDVSFALENLADKSLIHVRQGYVVMHRSLQEMGRKIVRIQSIDKPGEREFLVDPNDIHDILN

Gene3D: G3DSA:3.40.50.300
468-492 G3DSA:3.40.50.300

LENLADKSLIHVRQGYVVMHRSLQE

superfamily: SSF52058
534-923 SSF52058,LRR

ISLDIRNIRELDVHERAFKGMSNLRFLEIKNFGLKEDGLHLPPSFDYLPRTLKLLCWSKFPMRCMPFGFRPENLVKLEMQYSKLHKLWEGVAPLTCLKEMDLHGSSNLKVIPDLSEATNLEILNLKFCESLVELPSSIRNLNKLLNLDMLNCKSLKILPTGFNLKSLDRLNLYHCSKLKTFPKFSTNISVLNLNLTNIEDFPSNLHLENLVEFRISKEESDEKQWEEEKPLTPFLAMMLSPTLTSLHLENLPSLVELTSSFQNLNQLKDLIIINCINLETLPTGINLQSLDYLCFSGCSQLRSFPEISTNISVLYLDETAIEEVPWWIEKFSNLTELSMNSCSRLKCVFLHMSKLKHLKEALFRNCGTLTRVELSGYPSGMEVMKADNID

Gene3D: G3DSA:3.80.10.10
536-749 G3DSA:3.80.10.10

LDIRNIRELDVHERAFKGMSNLRFLEIKNFGLKEDGLHLPPSFDYLPRTLKLLCWSKFPMRCMPFGFRPENLVKLEMQYSKLHKLWEGVAPLTCLKEMDLHGSSNLKVIPDLSEATNLEILNLKFCESLVELPSSIRNLNKLLNLDMLNCKSLKILPTGFNLKSLDRLNLYHCSKLKTFPKFSTNISVLNLNLTNIEDFPSNLHLENLVEFRIS

HMMPfam: PF07725
IPR011713
606-624 LRR_3
Leucine-rich repeat 3

NLVKLEMQYSKLHKLWEGV

FPrintScan: PR00364
IPR000767
672-688 DISEASERSIST
Disease resistance protein

RNLNKLLNLDMLNCKSL

Gene3D: G3DSA:3.80.10.10
773-917 G3DSA:3.80.10.10

SPTLTSLHLENLPSLVELTSSFQNLNQLKDLIIINCINLETLPTGINLQSLDYLCFSGCSQLRSFPEISTNISVLYLDETAIEEVPWWIEKFSNLTELSMNSCSRLKCVFLHMSKLKHLKEALFRNCGTLTRVELSGYPSGMEVM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox