PRGDB00047105 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 42569092 (NM_127260)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT2G17050) mRNA, complete cds.

DNA Sequence

ATGGATTATGGTGCTTGTGAACTAGTGGAAGACATTGCTAGGGATATGTATGAAAAGATTTTCCCTACCAAACGAATTGGGATCTACAGGAAGATGCTGAAGTTAGAAAAAATTGTTTACAAGCAACTATGGGGTATCCGCAGCATAGGCATATGGGGTATGCCAGGCATAGGAAAAACAACACTTGCCGAAGCAGCATTTGACCAATTTTCTGGTGATTATGAAGCTTCTTGCATCATCAAAGACTTCGACAAAGAATTTCTTGCGAAAGGACTTTATCATTTGTGGAATGAATACTTAGGGGAAAATATAAACAATTCTTTTATCAAGTCCGGACAAAAAAGACTTCTTATCGTCCTTGACAATGTTCTTAAACCTCTGGATGCAGACGCTTTTCTTAATGGGTTTGATTGGTTTGGTCCAGGGAGCCTGATAATCATAACCTCTAGAGATAAACAAGTACTAGTGCAGTGTGGCGTCAACCAAATATATGAGGTTGAAGGTTTAAACAAAGATGAGGCTAAGCAACTACTTCACGGATGCGCATTTGGAATAGACTGGAGAAAACAGAGTGGGTTGGAAACTCTTGCACCTTACTATATTTCTGTCAAATATTTTAGTGGAAACCCTCTAGCTCTTAGCCTTTATGAAGAAATGTTGTCACACATGAAGTCAGATAAAATGGAGGTTAAGCTCCTCAAGCTCAACCACCCTCCACCTCAGATTATGGAAGTATTCAAGAGCAATTACAATGCACTTAATGAGAACGAGAAGAGCATGTTTCTAGACATTGCTTGTTTCTTCAGGGGAGAAAAGGCGGACTACGTGATGCAACTGTTTGAAGGATGTGGATTCTTTCCACATGTTGGAATATATGTTCTAGTGGATAAGTGTCTGGTGACTATTGTAAAAAGAAAGATGGAAATGCATAATCTGATCCAGATTGTTGGGAAGGCGATTTCAAATGAAGGAACTGTAGAACTTGATAGGCATGTCAGACTATGGGACACTTCAATCATTCAACCTCTGCTAGAAGATGAAGAAACCAAATTAAAGGGTGAATCTAAGGGTACTACTGAAGATATTGAAGTCATATTTCTAGACATGTCTAACTTGAAATTCTTTGTCAAACCTGATGCTTTCAAGAGTATGCATAATCTTAGATTTCTGAAGATTTATAGTTCTAATCCTGGAAAGCATCAGAGAATTCGCTTTCGAGAAGCTCTTCAGTCTCTTCCCAATGAGCTACGGCTACTCCACTGGGAGGATTATCCTCTACAATCCCTGCCACAACATTTTGATCCTACGCACCTTGTTGAACTCAACATGCCTTACAGTAAACTTCAAAAACTTTGGGGTGGAACCAAGAACCTTGAGATGTTGAAGATGGTCAGGCTTAGTCACTCGCAAGATCTAGTTGAAATTGAAGAACTGATAAAATCTAAAAATATTGAAGTAATCGATCTCCAAGGTTGTACAAAAATACAGAGTTTTCCAGCTACAAGACATCTACAACATCTCAGAGTTATTAATCTTTCTGGTTGCGTTGAGATCAAAAGCACACAGCTCGAAGAATTTCAGGGCTTTCCAAGGAACCTGAAAGAATTATATCTTTCTGGTACTGGGATAAGAGAAGTGACATCATCAATCCACCTCTCCTCACTTGAAGTTTTGGATTTGTCTAACTGCAAAAGACTTCAAAACTTGCCCATGGGAAAGGGTAATTTGGCTTCTCTTATTAAACTCATGTTATCAGGGTGTTCAAAGCTCCAGAATATTCAAGATCTCCCAACAAACCTGAAAGAGCTATATCTTGCTGGGACCTCTATAAGAGAAGTTCCATCATCAATCTGTCATCTCACTCAACTTGTTGTTTTCGATGCCGAGAACTGCAAGAAGCTTCAAGACTTGCCTATGGGAATGGGTAATTTGATCTCTCTGACTATGTTAATTTTATCTGGCTGCTCAGAGCTCAGGAGTATCCCCGATCTTCCACGGAACCTTAGACATTTAAATCTAGCCGAGACCCCCATAAAGAAACTGCCATCATCATTTGAGGATCTCACTAAACTGGTTTCACTAGATTTGAATCACTGCGAAAGGCTTCAACATCTCCAAATGGAATCTTTCGAATCAGTAGTTAGGGTGGATCTATCTGGCTGCTTAGAGCTGAAGTATATCCTAGGTTTCTCACTTCAAGACATTACACAACTTCATGAAGATGGGACCGACAAAGTGATGTTACATGGAACTCCTCCATGTAACGTCACCTTAATTTTAGAGACGTGGAGAACAAGACATGTCACTCCAATGGAAAAGAGTGGGTCTAAATTTTATCTTAAGCTTATGCCATTTGTAACCACGCCATATCGTTCAAAGTTGCAATCTTCCCTAGTGTTCCGTATGTATGCCATGGTATCTTTGTTTCTCAGTAAAGCATACCTCCTTGACATACATATACCTCAAGAGATATGTAATCTCCTTTCACTCAAGACATTGGATCTCAGTGGAAACAATTTTGGTAAACTTCCTGAAAGCATCAAGCAGTTCCGCAATTTGGAGAGCCTTATATTATGTCATTGCAAAAACCTCGAATCACTTCCAGAGCTTCCTCAAAGTCTAGAGTTTTTGAATGCACATGGTTGTGTGTGTCTAAAAAATATTCATAGGAGCTTCCAACAGTTTCCTAGACATTGCACATTCAGCAATTGCTTTGAGATTTCTCCAGACATCGTTAGGGAGATTTTAGAAGCAAGAGTTGCGCAAATGGTCATAGATCATACTCTGCAGAAGCTCATCGAAGCACCAGCATTCAGTTTCTCTGTTCCAGCATTCCGTGATCCAAATTACATCTTTCACTTAAACCGAGGTTCATCTGTGATGATACGTTTAACTCCTAGCATAGAAACGCTTTTGGGGTTCCAAATATCAGTTGCAGTTGCATTTTGGAATGATTCCTACAGTAATGCCGGTTTTGGAATCAGTCACATGTTTATCTTCTATGATGTCTCGATGCATCCATGTGTTGTTGATGGAAATGACTTCAATATATTGGATGATGTGGTTCATTTTGAATTGCTTCCGGTTAGCAGGGAGAACAAGATTCTTGATGATTGTTGCACTGTTACAGAGTGTGGAGTATATGCAATTACTGAAAACGTAGACCAAACAAATCTTGACTTTAGAGGACCGTCTTTTGCCTTGTTACCACCGTATAAGAAGCGAAAACGAAGTTTCTCGGGATCAGAAGACATTGAAATGGAAAACCAGAGGTTGAACATCTCAAAAACCAAACAAGGGGATGTCCCAGAAAAGATAAGCCAAGCCGATACGGCTTATCTCACATCACCTTCTTTGCTTCAACGTCGGAGCCATCAGGTTTTTTTGAGCTTCAGTGAGGATGTCCCAAGATATTTTGTCAGCTATTTAATCAAGAAATTAAAATGGATTGGCATTACTGTAGTATATAGTGGATTCATGGGAGGCAAGTCTATGAGTCGTCCCGAGGTAACACAAGCCATAGAAGAATCAAGTATCTCAGTCGTCATTCTATCAAAAGACTATGTTTCTTCAAGTAAGTGCTTGGATGAATTGGTGGAGATCATAAGGTGGAGGGAAGAAAACTTGGGAAACAGAGTGATGCCAATTTACTATGAAATGGGTACATCTGATGTAATGAAGCAAGCCAAAACTATTGGGAATAGATTGGTGGAAACCTATTTGGGGAAAGTAGTAGAGAAACCAGAGCTGAGATGGATGAGAGCTTTGGCATACATTGTCAATATAGTCGGTGAATCTTCCCAATACTGGGTTGACAAAGCGAAGATGATTGAGAAGACTGTTGTGGATGTCTCAAATCAAATGAATATCTTGGAATCAAATGAAGCTGGTTTATTGTTCATTTACCAGGAAGAGGAGAACATGGAAAACTTTAAGAGAAACGTTTACGATGAGATGAACGGTGTGCGCATCATTCCAATCTGGCATGTATATGCATTTTTGTTGATTTATCTGTTTCTTCTTATTTTAAAATCACGCTTTATACTACGAGACGTGATCCACAAGTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MDYGACELVEDIARDMYEKIFPTKRIGIYRKMLKLEKIVYKQLWGIRSIGIWGMPGIGKTTLAEAAFDQFSGDYEASCIIKDFDKEFLAKGLYHLWNEYLGENINNSFIKSGQKRLLIVLDNVLKPLDADAFLNGFDWFGPGSLIIITSRDKQVLVQCGVNQIYEVEGLNKDEAKQLLHGCAFGIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKLNHPPPQIMEVFKSNYNALNENEKSMFLDIACFFRGEKADYVMQLFEGCGFFPHVGIYVLVDKCLVTIVKRKMEMHNLIQIVGKAISNEGTVELDRHVRLWDTSIIQPLLEDEETKLKGESKGTTEDIEVIFLDMSNLKFFVKPDAFKSMHNLRFLKIYSSNPGKHQRIRFREALQSLPNELRLLHWEDYPLQSLPQHFDPTHLVELNMPYSKLQKLWGGTKNLEMLKMVRLSHSQDLVEIEELIKSKNIEVIDLQGCTKIQSFPATRHLQHLRVINLSGCVEIKSTQLEEFQGFPRNLKELYLSGTGIREVTSSIHLSSLEVLDLSNCKRLQNLPMGKGNLASLIKLMLSGCSKLQNIQDLPTNLKELYLAGTSIREVPSSICHLTQLVVFDAENCKKLQDLPMGMGNLISLTMLILSGCSELRSIPDLPRNLRHLNLAETPIKKLPSSFEDLTKLVSLDLNHCERLQHLQMESFESVVRVDLSGCLELKYILGFSLQDITQLHEDGTDKVMLHGTPPCNVTLILETWRTRHVTPMEKSGSKFYLKLMPFVTTPYRSKLQSSLVFRMYAMVSLFLSKAYLLDIHIPQEICNLLSLKTLDLSGNNFGKLPESIKQFRNLESLILCHCKNLESLPELPQSLEFLNAHGCVCLKNIHRSFQQFPRHCTFSNCFEISPDIVREILEARVAQMVIDHTLQKLIEAPAFSFSVPAFRDPNYIFHLNRGSSVMIRLTPSIETLLGFQISVAVAFWNDSYSNAGFGISHMFIFYDVSMHPCVVDGNDFNILDDVVHFELLPVSRENKILDDCCTVTECGVYAITENVDQTNLDFRGPSFALLPPYKKRKRSFSGSEDIEMENQRLNISKTKQGDVPEKISQADTAYLTSPSLLQRRSHQVFLSFSEDVPRYFVSYLIKKLKWIGITVVYSGFMGGKSMSRPEVTQAIEESSISVVILSKDYVSSSKCLDELVEIIRWREENLGNRVMPIYYEMGTSDVMKQAKTIGNRLVETYLGKVVEKPELRWMRALAYIVNIVGESSQYWVDKAKMIEKTVVDVSNQMNILESNEAGLLFIYQEEENMENFKRNVYDEMNGVRIIPIWHVYAFLLIYLFLLILKSRFILRDVIHK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
7-1060 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ELVEDIARDMYEKIFPTKRIGIYRKMLKLEKIVYKQLWGIRSIGIWGMPGIGKTTLAEAAFDQFSGDYEASCIIKDFDKEFLAKGLYHLWNEYLGENINNSFIKSGQKRLLIVLDNVLKPLDADAFLNGFDWFGPGSLIIITSRDKQVLVQCGVNQIYEVEGLNKDEAKQLLHGCAFGIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKLNHPPPQIMEVFKSNYNALNENEKSMFLDIACFFRGEKADYVMQLFEGCGFFPHVGIYVLVDKCLVTIVKRKMEMHNLIQIVGKAISNEGTVELDRHVRLWDTSIIQPLLEDEETKLKGESKGTTEDIEVIFLDMSNLKFFVKPDAFKSMHNLRFLKIYSSNPGKHQRIRFREALQSLPNELRLLHWEDYPLQSLPQHFDPTHLVELNMPYSKLQKLWGGTKNLEMLKMVRLSHSQDLVEIEELIKSKNIEVIDLQGCTKIQSFPATRHLQHLRVINLSGCVEIKSTQLEEFQGFPRNLKELYLSGTGIREVTSSIHLSSLEVLDLSNCKRLQNLPMGKGNLASLIKLMLSGCSKLQNIQDLPTNLKELYLAGTSIREVPSSICHLTQLVVFDAENCKKLQDLPMGMGNLISLTMLILSGCSELRSIPDLPRNLRHLNLAETPIKKLPSSFEDLTKLVSLDLNHCERLQHLQMESFESVVRVDLSGCLELKYILGFSLQDITQLHEDGTDKVMLHGTPPCNVTLILETWRTRHVTPMEKSGSKFYLKLMPFVTTPYRSKLQSSLVFRMYAMVSLFLSKAYLLDIHIPQEICNLLSLKTLDLSGNNFGKLPESIKQFRNLESLILCHCKNLESLPELPQSLEFLNAHGCVCLKNIHRSFQQFPRHCTFSNCFEISPDIVREILEARVAQMVIDHTLQKLIEAPAFSFSVPAFRDPNYIFHLNRGSSVMIRLTPSIETLLGFQISVAVAFWNDSYSNAGFGISHMFIFYDVSMHPCVVDGNDFNILDDVVHFELLPVSRENKILDDCCTVTECGVYAITENVDQTNLD

HMMPanther: PTHR11017:SF20
7-1060 PTHR11017:SF20,SUBFAMILY NOT NAMED

ELVEDIARDMYEKIFPTKRIGIYRKMLKLEKIVYKQLWGIRSIGIWGMPGIGKTTLAEAAFDQFSGDYEASCIIKDFDKEFLAKGLYHLWNEYLGENINNSFIKSGQKRLLIVLDNVLKPLDADAFLNGFDWFGPGSLIIITSRDKQVLVQCGVNQIYEVEGLNKDEAKQLLHGCAFGIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKLNHPPPQIMEVFKSNYNALNENEKSMFLDIACFFRGEKADYVMQLFEGCGFFPHVGIYVLVDKCLVTIVKRKMEMHNLIQIVGKAISNEGTVELDRHVRLWDTSIIQPLLEDEETKLKGESKGTTEDIEVIFLDMSNLKFFVKPDAFKSMHNLRFLKIYSSNPGKHQRIRFREALQSLPNELRLLHWEDYPLQSLPQHFDPTHLVELNMPYSKLQKLWGGTKNLEMLKMVRLSHSQDLVEIEELIKSKNIEVIDLQGCTKIQSFPATRHLQHLRVINLSGCVEIKSTQLEEFQGFPRNLKELYLSGTGIREVTSSIHLSSLEVLDLSNCKRLQNLPMGKGNLASLIKLMLSGCSKLQNIQDLPTNLKELYLAGTSIREVPSSICHLTQLVVFDAENCKKLQDLPMGMGNLISLTMLILSGCSELRSIPDLPRNLRHLNLAETPIKKLPSSFEDLTKLVSLDLNHCERLQHLQMESFESVVRVDLSGCLELKYILGFSLQDITQLHEDGTDKVMLHGTPPCNVTLILETWRTRHVTPMEKSGSKFYLKLMPFVTTPYRSKLQSSLVFRMYAMVSLFLSKAYLLDIHIPQEICNLLSLKTLDLSGNNFGKLPESIKQFRNLESLILCHCKNLESLPELPQSLEFLNAHGCVCLKNIHRSFQQFPRHCTFSNCFEISPDIVREILEARVAQMVIDHTLQKLIEAPAFSFSVPAFRDPNYIFHLNRGSSVMIRLTPSIETLLGFQISVAVAFWNDSYSNAGFGISHMFIFYDVSMHPCVVDGNDFNILDDVVHFELLPVSRENKILDDCCTVTECGVYAITENVDQTNLD

superfamily: SSF52540
13-235 SSF52540

ARDMYEKIFPTKRIGIYRKMLKLEKIVYKQLWGIRSIGIWGMPGIGKTTLAEAAFDQFSGDYEASCIIKDFDKEFLAKGLYHLWNEYLGENINNSFIKSGQKRLLIVLDNVLKPLDADAFLNGFDWFGPGSLIIITSRDKQVLVQCGVNQIYEVEGLNKDEAKQLLHGCAFGIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKL

HMMPfam: PF00931
IPR002182
46-287 NB-ARC,NBS
NB-ARC

IRSIGIWGMPGIGKTTLAEAAFDQFSGDYEASCIIKDFDKEFLAKGLYHLWNEYLGENINNSFIKSGQKRLLIVLDNVLKPLDADAFLNGFDWFGPGSLIIITSRDKQVLVQCGVNQIYEVEGLNKDEAKQLLHGCAFGIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKLNHPPPQIMEVFKSNYNALNENEKSMFLDIACFFRGEKADYVMQLFEGCGFFP

Gene3D: G3DSA:3.40.50.300
46-151 G3DSA:3.40.50.300

IRSIGIWGMPGIGKTTLAEAAFDQFSGDYEASCIIKDFDKEFLAKGLYHLWNEYLGENINNSFIKSGQKRLLIVLDNVLKPLDADAFLNGFDWFGPGSLIIITSRD

FPrintScan: PR00364
IPR000767
48-63 DISEASERSIST
Disease resistance protein

SIGIWGMPGIGKTTLA

FPrintScan: PR00364
IPR000767
110-124 DISEASERSIST
Disease resistance protein

KSGQKRLLIVLDNVL

FPrintScan: PR00364
IPR000767
206-220 DISEASERSIST
Disease resistance protein

FSGNPLALSLYEEML

superfamily: SSF46785
240-345 SSF46785

PQIMEVFKSNYNALNENEKSMFLDIACFFRGEKADYVMQLFEGCGFFPHVGIYVLVDKCLVTIVKRKMEMHNLIQIVGKAISNEGTVELDRHVRLWDTSIIQPLLE

superfamily: SSF52058
364-769 SSF52058,LRR

VIFLDMSNLKFFVKPDAFKSMHNLRFLKIYSSNPGKHQRIRFREALQSLPNELRLLHWEDYPLQSLPQHFDPTHLVELNMPYSKLQKLWGGTKNLEMLKMVRLSHSQDLVEIEELIKSKNIEVIDLQGCTKIQSFPATRHLQHLRVINLSGCVEIKSTQLEEFQGFPRNLKELYLSGTGIREVTSSIHLSSLEVLDLSNCKRLQNLPMGKGNLASLIKLMLSGCSKLQNIQDLPTNLKELYLAGTSIREVPSSICHLTQLVVFDAENCKKLQDLPMGMGNLISLTMLILSGCSELRSIPDLPRNLRHLNLAETPIKKLPSSFEDLTKLVSLDLNHCERLQHLQMESFESVVRVDLSGCLELKYILGFSLQDITQLHEDGTDKVMLHGTPPCNVTLILETWRTRHVT

Gene3D: G3DSA:3.80.10.10
364-515 G3DSA:3.80.10.10

VIFLDMSNLKFFVKPDAFKSMHNLRFLKIYSSNPGKHQRIRFREALQSLPNELRLLHWEDYPLQSLPQHFDPTHLVELNMPYSKLQKLWGGTKNLEMLKMVRLSHSQDLVEIEELIKSKNIEVIDLQGCTKIQSFPATRHLQHLRVINLSGC

HMMPfam: PF07725
IPR011713
437-456 LRR_3
Leucine-rich repeat 3

HLVELNMPYSKLQKLWGGTK

Gene3D: G3DSA:3.80.10.10
516-738 G3DSA:3.80.10.10

VEIKSTQLEEFQGFPRNLKELYLSGTGIREVTSSIHLSSLEVLDLSNCKRLQNLPMGKGNLASLIKLMLSGCSKLQNIQDLPTNLKELYLAGTSIREVPSSICHLTQLVVFDAENCKKLQDLPMGMGNLISLTMLILSGCSELRSIPDLPRNLRHLNLAETPIKKLPSSFEDLTKLVSLDLNHCERLQHLQMESFESVVRVDLSGCLELKYILGFSLQDITQL

ProfileScan: PS51450
IPR001611
532-553 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKELYLSGTGIREVTSSIHLS

FPrintScan: PR00364
IPR000767
550-566 DISEASERSIST
Disease resistance protein

IHLSSLEVLDLSNCKRL

HMMPfam: PF00560
IPR001611
554-570 LRR_1
Leucine-rich repeat

SLEVLDLSNCKRLQNLP

ProfileScan: PS51450
IPR001611
554-576 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEVLDLSNCKRLQNLPMGKGNL

ProfileScan: PS51450
IPR001611
599-620 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKELYLAGTSIREVPSSICHL

ProfileScan: PS51450
IPR001611
646-666 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTMLILSGCSELRSIPDLPR

HMMPfam: PF12799
667-699 LRR_4,Leucine Rich repeats (2 copies)

NLRHLNLAETPIKKLPSSFEDLTKLVSLDLNHC

ProfileScan: PS51450
IPR001611
667-689 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRHLNLAETPIKKLPSSFEDLT

superfamily: SSF52058
790-891 SSF52058,LRR

YRSKLQSSLVFRMYAMVSLFLSKAYLLDIHIPQEICNLLSLKTLDLSGNNFGKLPESIKQFRNLESLILCHCKNLESLPELPQSLEFLNAHGCVCLKNIHRS

Gene3D: G3DSA:3.80.10.10
802-915 G3DSA:3.80.10.10

MYAMVSLFLSKAYLLDIHIPQEICNLLSLKTLDLSGNNFGKLPESIKQFRNLESLILCHCKNLESLPELPQSLEFLNAHGCVCLKNIHRSFQQFPRHCTFSNCFEISPDIVREI

HMMPfam: PF12799
829-871 LRR_4,Leucine Rich repeats (2 copies)

SLKTLDLSGNNFGKLPESIKQFRNLESLILCHCKNLESLPELP

ProfileScan: PS51450
IPR001611
829-850 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKTLDLSGNNFGKLPESIKQF

ProfileScan: PS51450
IPR001611
852-874 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLESLILCHCKNLESLPELPQSL

superfamily: SSF52200
IPR000157
1113-1265 TIR
Toll/interleukin-1 receptor homology (TIR) domain

YLTSPSLLQRRSHQVFLSFSEDVPRYFVSYLIKKLKWIGITVVYSGFMGGKSMSRPEVTQAIEESSISVVILSKDYVSSSKCLDELVEIIRWREENLGNRVMPIYYEMGTSDVMKQAKTIGNRLVETYLGKVVEKPELRWMRALAYIVNIVGE

Gene3D: G3DSA:3.40.50.10140
1123-1241 G3DSA:3.40.50.10140

RSHQVFLSFSEDVPRYFVSYLIKKLKWIGITVVYSGFMGGKSMSRPEVTQAIEESSISVVILSKDYVSSSKCLDELVEIIRWREENLGNRVMPIYYEMGTSDVMKQAKTIGNRLVETYL

ProfileScan: PS50104
IPR000157
1123-1262 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RSHQVFLSFSEDVPRYFVSYLIKKLKWIGITVVYSGFMGGKSMSRPEVTQAIEESSISVVILSKDYVSSSKCLDELVEIIRWREENLGNRVMPIYYEMGTSDVMKQAKTIGNRLVETYLGKVVEKPELRWMRALAYIVNI

HMMSmart: SM00255
IPR000157
1124-1262 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SHQVFLSFSEDVPRYFVSYLIKKLKWIGITVVYSGFMGGKSMSRPEVTQAIEESSISVVILSKDYVSSSKCLDELVEIIRWREENLGNRVMPIYYEMGTSDVMKQAKTIGNRLVETYLGKVVEKPELRWMRALAYIVNI

HMMPfam: PF01582
IPR000157
1127-1256 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFSEDVPRYFVSYLIKKLKWIGITVVYSGFMGGKSMSRPEVTQAIEESSISVVILSKDYVSSSKCLDELVEIIRWREENLGNRVMPIYYEMGTSDVMKQAKTIGNRLVETYLGKVVEKPELRWMRAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox