PRGDB00047107 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30696079 (NM_124542)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G51630) mRNA, complete cds.

DNA Sequence

ATGATCTCAATCGTGGTATTCTCTAAGAAGTATGCTTCTTCCACCTGGTGCTTGAATGAATTGGTGGAGATCCACAAGTGTTATAAGGAGTTGACTCAAATTGTCATTCCGATTTTCTACGAAGTTGATCCTTCTGATGTTAGAAAGCAAACCAGAGAGTTTGGCGAGTTCTTTAAAGTGACCTGCGTGGGGAAAACAGAAGATGTGAAGCAACAATGGATAGAAGCTCTTGAAGAGGTAGCAAGTATAGCCGGACATGATTCTAAGAATTGGCCTAACGAAGCAAACATGATTGAACATATCGCCAAAGATGTGTTAAATAAACTTATTGCAACATCATCATCGAATTGTTTTGGAGATCTTGTCGGGATCGAAGCTCATTTAAAGGCAGTGAAGTCAATCTTGTGCTTGGAATCTGAGGAAGCAAGAATGGTAGGGATTTTGGGGCCTTCAGGCATTGGTAAGACTACCATAGCTAGAATTTTATACAGTAAGCTCTCTAGCCAATTCGACTATCACGTTTTTGGTTCTTTTAAGAGAACCAACCAGGACAACTATGGCATGAAGTTGAGTTGGGAAGAGCAGTTTCTGTCAGAAATTCTAGATCAAAAGGACCTAAAGATAAGCCAATTAGGTGTGGTGAAACAGAGGCTAAAGCATAAGAAAGTACTTATCGTTCTTGATGATGTGGATAATCTAGAGCTATTAAAGACTTTAGTGGGACAAACCGGGTGGTTTGGACCTGGAAGCAGAATTATCGTGACCACTCAAGATAGGATCCTTCTCAAGTCTCACAAGATTGATCATATTTATGAGGTGGGGTACCCATCGAGAAAATTGGCTCTTCGGATTTTATGTCGATCTGCTTTCGACAGAAACTCCCCACCTGATGGTTTCATGCAGCTTGCAAATGAAGTTACAGAGCTTGTTGGTAATCTTCCTTTGGCTCTCAATATCATGGGTTCGTCTTTGAAAGGGAGGGACAAGGAAGAGTGGATAGAGATGATGCCTAGTCTCCGAAATAGTTTGGTGGATGGAGAAATTCTGAAAACATTAAGAGTCAGCTATGATCGATTACATGGGAATTATCAAGAAATATTCCTTTATATTGCGTGTTTACTAAATTGCTGTGGAGTCGAATACATTATAAGCATGCTTGGAGATAATGCTATCATTGGGTTGAAAATACTGGCTGAGAAGTCCCTCATACATATATCACCACTGGACAAAACTGTAGAGATGCACAGTTTGCTACAAAAGTTGGGTAGAAAGATTGTTCGTGATGAATCCTTTGGAAATCCTGGAAAACGCCGGTTCTTGTTGGATGCTGAGGATATTTGTGATGTATTTACCGATAATACCGGCACAGAAACTGTACTAGGTATATCTCTTAACACATTGGAAATCAACGGGACATTGTCTGTAGATGATAAATCATTCCAAGGTATGCATAATCTCCAATTTCTTAAAGTTTTCGAGAATTGGCGGCGGGGGAGTGGTGAAGGCATATTGTCTTTACCTCAAGGCCTCAATTCTTTGCCCCGAAAACTCAGACTACTACACTGGTATAAATTCCCGTTGAGGTGTATGCCTTCTAACTTCAAGGCCGAGTATCTGGTTAACCTAGAAATGGCGTATAGCCAGCTTGAGAGGTTGTGGGAAGGAACTCAGCAACTTGGAAGTCTCAAGAAGATGGATCTGTCCAAGTCCGAAAATTTGAAAGAAATTCCAGATCTTTCTTACGCCGTAAATCTAGAGGAAATGGATCTTTGCAGTTGTAAATCTTTGGTAACACTTCCTTCCTCAGTTCGAAATCTTGATAAACTTAGGGTGTTAAGAATGAGTAGCTGCTCAAATGTCGAAGTTCTTCCAACTGATCTCAACTTGGAATCTCTCGATCTCCTTAATCTTGAAGATTGCTCACAGTTGAGAAGTTTTCCTCAGATTTCAAGGAACATTTCAATTCTTAATCTAAGTGGAACTGCAATAGACGAAGAAAGTTCTTTATGGATAGAGAATATGTCTAGGCTCACTCATCTCCGCTGGGACTTTTGTCCACTGAAAAGTCTGCCTTCTAACTTTCGTCAAGAACATCTCGTTTCTTTACATATGACACATAGCAAGCTTGAGAAGTTATGGGAAGGAGCCCAGCCTTTTGGAAATCTCGTGAATATTGATCTTTCGCTATCTGAAAAGCTGAAAGAATTTCCAAATCTTTCAAAGGTCACCAATCTCGATACGTTGGATCTTTATGGTTGCAAAAGTTTGGTGACAGTTCCCTCCTCAATTCAGAGTCTCAGTAAGCTGACGGAATTGAACATGAGAAGATGCACAGGTCTCGAGGCTCTTCCTACGGATGTGAACTTGGAATCTCTTCATACTCTAGATCTCAGTGGGTGCTCAAAGTTGACAACTTTTCCTAAGATTTCAAGAAACATTGAACGTCTCCTTCTGGACGACACTGCGATTGAAGAAGTTCCTTCGTGGATTGATGATTTCTTTGAGCTCACTACACTCAGTATGAAAGGTTGCAAGAGGTTAAGAAACATCTCTACAAGCATTTGTGAATTGAAATGTATTGAGGTGGCAAACTTCTCTGACTGTGAAAGACTCACAGAATTTGATGATGCAAGTATGGTAAGAAGAATCTTACGCACCATTGATGATCTGATAGCACTGTACGAGGAGGCTTCATTTCTTCATGCAATATTTGTACTGTGCAGAAAACTCGTATCAATATGTGCAATGGTTTTTAAATATCCCCAAGCTCTCTCTTACTTCTTCAACAGTCCAGAGGCTGATCTCATTTTCGCTAACTGCTCCAGTTTGGATCGAGATGCGGAGACACTCATCCTAGAATCAAATCACGGGTGCGCGGTCTTACCAGGTGGAAAAGTGCCTAACTGTTTCATGAATCAAGCTTGTGGAAGTTCCGTATCTATTCCTTTACATGAGAGCTATTATTCTGAAGAATTTCTTGGCTTTAAGGCTTGCATTGTGCTTGAAACTCCGCCTGACCTGAATTTTAAACAATCGTGGATTTGGGTACGCTGCTATTTCAGAGACAAATGTGTCGAGCATAGTGTCCAGTTTTCCTGGGACTCGAATAAGATGGATCACCTGCTTATGATCAACTTTCGGCTCCCTACAAAAGAAATAATTGGATGTCCATCTCAATTGGACACCGATGACTTGATGTTTTTTTTTTACCACCATATGTATTATGCTTGTAATTCCTACGTAAATCCTTCTCCATGCTCAGTCCAAAGGATAAAAGGATGTGGTATAAAATTTTGGGATGTCTCTCCCAGAGTTCTATCTCAAAGTGAGCTTGATACTTACTTCTCCTGGCCAGTTAAAGGTGAAGGTGAAGCTGAAGGTGAAAGTGAAGGTGAAAGCGAAGACGAACAAGAAGAAGACGAAGATGAAGATGCATATTTGGAGATTGAGGATGACTCGAGCTTGTCGTCGTTTGTGGAGGAGAATATTGGTGAATCTTTTCTAAATACAAACACCTTAGTTCGGTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEVASIAGHDSKNWPNEANMIEHIAKDVLNKLIATSSSNCFGDLVGIEAHLKAVKSILCLESEEARMVGILGPSGIGKTTIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPSRKLALRILCRSAFDRNSPPDGFMQLANEVTELVGNLPLALNIMGSSLKGRDKEEWIEMMPSLRNSLVDGEILKTLRVSYDRLHGNYQEIFLYIACLLNCCGVEYIISMLGDNAIIGLKILAEKSLIHISPLDKTVEMHSLLQKLGRKIVRDESFGNPGKRRFLLDAEDICDVFTDNTGTETVLGISLNTLEINGTLSVDDKSFQGMHNLQFLKVFENWRRGSGEGILSLPQGLNSLPRKLRLLHWYKFPLRCMPSNFKAEYLVNLEMAYSQLERLWEGTQQLGSLKKMDLSKSENLKEIPDLSYAVNLEEMDLCSCKSLVTLPSSVRNLDKLRVLRMSSCSNVEVLPTDLNLESLDLLNLEDCSQLRSFPQISRNISILNLSGTAIDEESSLWIENMSRLTHLRWDFCPLKSLPSNFRQEHLVSLHMTHSKLEKLWEGAQPFGNLVNIDLSLSEKLKEFPNLSKVTNLDTLDLYGCKSLVTVPSSIQSLSKLTELNMRRCTGLEALPTDVNLESLHTLDLSGCSKLTTFPKISRNIERLLLDDTAIEEVPSWIDDFFELTTLSMKGCKRLRNISTSICELKCIEVANFSDCERLTEFDDASMVRRILRTIDDLIALYEEASFLHAIFVLCRKLVSICAMVFKYPQALSYFFNSPEADLIFANCSSLDRDAETLILESNHGCAVLPGGKVPNCFMNQACGSSVSIPLHESYYSEEFLGFKACIVLETPPDLNFKQSWIWVRCYFRDKCVEHSVQFSWDSNKMDHLLMINFRLPTKEIIGCPSQLDTDDLMFFFYHHMYYACNSYVNPSPCSVQRIKGCGIKFWDVSPRVLSQSELDTYFSWPVKGEGEAEGESEGESEDEQEEDEDEDAYLEIEDDSSLSSFVEENIGESFLNTNTLVR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-1173 PTHR11017:SF20,SUBFAMILY NOT NAMED

MISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEVASIAGHDSKNWPNEANMIEHIAKDVLNKLIATSSSNCFGDLVGIEAHLKAVKSILCLESEEARMVGILGPSGIGKTTIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPSRKLALRILCRSAFDRNSPPDGFMQLANEVTELVGNLPLALNIMGSSLKGRDKEEWIEMMPSLRNSLVDGEILKTLRVSYDRLHGNYQEIFLYIACLLNCCGVEYIISMLGDNAIIGLKILAEKSLIHISPLDKTVEMHSLLQKLGRKIVRDESFGNPGKRRFLLDAEDICDVFTDNTGTETVLGISLNTLEINGTLSVDDKSFQGMHNLQFLKVFENWRRGSGEGILSLPQGLNSLPRKLRLLHWYKFPLRCMPSNFKAEYLVNLEMAYSQLERLWEGTQQLGSLKKMDLSKSENLKEIPDLSYAVNLEEMDLCSCKSLVTLPSSVRNLDKLRVLRMSSCSNVEVLPTDLNLESLDLLNLEDCSQLRSFPQISRNISILNLSGTAIDEESSLWIENMSRLTHLRWDFCPLKSLPSNFRQEHLVSLHMTHSKLEKLWEGAQPFGNLVNIDLSLSEKLKEFPNLSKVTNLDTLDLYGCKSLVTVPSSIQSLSKLTELNMRRCTGLEALPTDVNLESLHTLDLSGCSKLTTFPKISRNIERLLLDDTAIEEVPSWIDDFFELTTLSMKGCKRLRNISTSICELKCIEVANFSDCERLTEFDDASMVRRILRTIDDLIALYEEASFLHAIFVLCRKLVSICAMVFKYPQALSYFFNSPEADLIFANCSSLDRDAETLILESNHGCAVLPGGKVPNCFMNQACGSSVSIPLHESYYSEEFLGFKACIVLETPPDLNFKQSWIWVRCYFRDKCVEHSVQFSWDSNKMDHLLMINFRLPTKEIIGCPSQLDTDDLMFFFYHHMYYACNSYVNPSPCSVQRIKGCGIKFWDVSPRVLSQSELDTYFSWPVKGEGEAEGESEGESEDEQEEDEDEDAYLEIEDDSSLSSFVEENIGESFLNTNTL

ProfileScan: PS50104
IPR000157
1-83 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEVASI

HMMPanther: PTHR11017
1-1173 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEVASIAGHDSKNWPNEANMIEHIAKDVLNKLIATSSSNCFGDLVGIEAHLKAVKSILCLESEEARMVGILGPSGIGKTTIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPSRKLALRILCRSAFDRNSPPDGFMQLANEVTELVGNLPLALNIMGSSLKGRDKEEWIEMMPSLRNSLVDGEILKTLRVSYDRLHGNYQEIFLYIACLLNCCGVEYIISMLGDNAIIGLKILAEKSLIHISPLDKTVEMHSLLQKLGRKIVRDESFGNPGKRRFLLDAEDICDVFTDNTGTETVLGISLNTLEINGTLSVDDKSFQGMHNLQFLKVFENWRRGSGEGILSLPQGLNSLPRKLRLLHWYKFPLRCMPSNFKAEYLVNLEMAYSQLERLWEGTQQLGSLKKMDLSKSENLKEIPDLSYAVNLEEMDLCSCKSLVTLPSSVRNLDKLRVLRMSSCSNVEVLPTDLNLESLDLLNLEDCSQLRSFPQISRNISILNLSGTAIDEESSLWIENMSRLTHLRWDFCPLKSLPSNFRQEHLVSLHMTHSKLEKLWEGAQPFGNLVNIDLSLSEKLKEFPNLSKVTNLDTLDLYGCKSLVTVPSSIQSLSKLTELNMRRCTGLEALPTDVNLESLHTLDLSGCSKLTTFPKISRNIERLLLDDTAIEEVPSWIDDFFELTTLSMKGCKRLRNISTSICELKCIEVANFSDCERLTEFDDASMVRRILRTIDDLIALYEEASFLHAIFVLCRKLVSICAMVFKYPQALSYFFNSPEADLIFANCSSLDRDAETLILESNHGCAVLPGGKVPNCFMNQACGSSVSIPLHESYYSEEFLGFKACIVLETPPDLNFKQSWIWVRCYFRDKCVEHSVQFSWDSNKMDHLLMINFRLPTKEIIGCPSQLDTDDLMFFFYHHMYYACNSYVNPSPCSVQRIKGCGIKFWDVSPRVLSQSELDTYFSWPVKGEGEAEGESEGESEDEQEEDEDEDAYLEIEDDSSLSSFVEENIGESFLNTNTL

HMMPfam: PF01582
IPR000157
2-77 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEAL

Gene3D: G3DSA:3.40.50.10140
2-80 G3DSA:3.40.50.10140

ISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEV

superfamily: SSF52200
IPR000157
2-86 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEVASIAGH

superfamily: SSF52540
104-345 SSF52540

DVLNKLIATSSSNCFGDLVGIEAHLKAVKSILCLESEEARMVGILGPSGIGKTTIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPSRKLALRILCRSAFDRNSPPDGFMQLANEVTELVGNLPLALNIMGSSLKGRDKEEWIEMMPSLRNSLVD

Gene3D: G3DSA:3.40.50.300
118-156 G3DSA:3.40.50.300

FGDLVGIEAHLKAVKSILCLESEEARMVGILGPSGIGKT

HMMPfam: PF00931
IPR002182
125-378 NB-ARC,NBS
NB-ARC

EAHLKAVKSILCLESEEARMVGILGPSGIGKTTIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPSRKLALRILCRSAFDRNSPPDGFMQLANEVTELVGNLPLALNIMGSSLKGRDKEEWIEMMPSLRNSLVDGEILKTLRVSYDRLHGNYQEIFLYIACLLNCCG

HMMSmart: SM00382
IPR003593
141-277 AAA,NBS
AAA+ ATPase domain

EARMVGILGPSGIGKTTIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPS

FPrintScan: PR00364
IPR000767
144-159 DISEASERSIST
Disease resistance protein

MVGILGPSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
157-292 G3DSA:3.40.50.300

TIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPSRKLALRILCRSAFDR

FPrintScan: PR00364
IPR000767
217-231 DISEASERSIST
Disease resistance protein

RLKHKKVLIVLDDVD

FPrintScan: PR00364
IPR000767
310-324 DISEASERSIST
Disease resistance protein

VGNLPLALNIMGSSL

superfamily: SSF46785
346-451 SSF46785

GEILKTLRVSYDRLHGNYQEIFLYIACLLNCCGVEYIISMLGDNAIIGLKILAEKSLIHISPLDKTVEMHSLLQKLGRKIVRDESFGNPGKRRFLLDAEDICDVFT

superfamily: SSF52058
413-694 SSF52058,LRR

EMHSLLQKLGRKIVRDESFGNPGKRRFLLDAEDICDVFTDNTGTETVLGISLNTLEINGTLSVDDKSFQGMHNLQFLKVFENWRRGSGEGILSLPQGLNSLPRKLRLLHWYKFPLRCMPSNFKAEYLVNLEMAYSQLERLWEGTQQLGSLKKMDLSKSENLKEIPDLSYAVNLEEMDLCSCKSLVTLPSSVRNLDKLRVLRMSSCSNVEVLPTDLNLESLDLLNLEDCSQLRSFPQISRNISILNLSGTAIDEESSLWIENMSRLTHLRWDFCPLKSLPSNF

Gene3D: G3DSA:3.80.10.10
511-683 G3DSA:3.80.10.10

NSLPRKLRLLHWYKFPLRCMPSNFKAEYLVNLEMAYSQLERLWEGTQQLGSLKKMDLSKSENLKEIPDLSYAVNLEEMDLCSCKSLVTLPSSVRNLDKLRVLRMSSCSNVEVLPTDLNLESLDLLNLEDCSQLRSFPQISRNISILNLSGTAIDEESSLWIENMSRLTHLRWD

HMMPfam: PF07725
IPR011713
538-557 LRR_3
Leucine-rich repeat 3

YLVNLEMAYSQLERLWEGTQ

superfamily: SSF52047
651-872 SSF52047,LRR

RNISILNLSGTAIDEESSLWIENMSRLTHLRWDFCPLKSLPSNFRQEHLVSLHMTHSKLEKLWEGAQPFGNLVNIDLSLSEKLKEFPNLSKVTNLDTLDLYGCKSLVTVPSSIQSLSKLTELNMRRCTGLEALPTDVNLESLHTLDLSGCSKLTTFPKISRNIERLLLDDTAIEEVPSWIDDFFELTTLSMKGCKRLRNISTSICELKCIEVANFSDCERLT

Gene3D: G3DSA:3.80.10.10
684-874 G3DSA:3.80.10.10

FCPLKSLPSNFRQEHLVSLHMTHSKLEKLWEGAQPFGNLVNIDLSLSEKLKEFPNLSKVTNLDTLDLYGCKSLVTVPSSIQSLSKLTELNMRRCTGLEALPTDVNLESLHTLDLSGCSKLTTFPKISRNIERLLLDDTAIEEVPSWIDDFFELTTLSMKGCKRLRNISTSICELKCIEVANFSDCERLTEF

HMMPfam: PF07725
IPR011713
698-717 LRR_3
Leucine-rich repeat 3

HLVSLHMTHSKLEKLWEGAQ

FPrintScan: PR00364
IPR000767
787-803 DISEASERSIST
Disease resistance protein

VNLESLHTLDLSGCSKL

HMMPfam: PF00560
IPR001611
791-809 LRR_1
Leucine-rich repeat

SLHTLDLSGCSKLTTFPKI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox