PRGDB00047109 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30684792 (NM_179079)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT4G19510) mRNA, complete cds.

DNA Sequence

ATGGCTTTTGCTTCTTCTTCCTCTTCTATAGTTCTCTCCAAATGCGAATTCGACGTGTTCGTGAGTTTCAGAGGCGCGGATACGCGTCATGACTTCACTTCTCACCTCGTTAAGTACCTGCGTGGGAAAGGTATCGATGTTTTCTCCGATGCCAAACTCCGGGGAGGTGAGTACATCTCGCTTCTCTTTGACAGGATCGAGCAATCGAAGATGTCAATCGTTGTCTTCTCAGAGGATTACGCCAACTCCTGGTGGTGCTTGGAGGAAGTCGGGAAGATTATGCAGCGCAGGAAAGAATTCAATCATGGAGTTTTACCGATCTTCTACAAAGTCAGTAAATCTGATGTTTCGAATCAGACAGGGAGTTTTGAAGCCGTATTCCAGAGCCCCACAAAGATTTTTAATGGAGATGAACAAAAAATTGAGGAATTGAAGGTTGCTCTGAAGACAGCTTCCAATATCCGTGGCTTTGTATATCCTGAGAACAGCTCGGAGCCTGATTTTTTAGATGAAATCGTGAAGAATACTTTCAGGATGCTGAATGAATTGTCTCCATGTGTAATCCCTGATGATCTACCAGGAATTGAATCACGTTCCAAGGAACTGGAGAAGCTATTGATGTTCGATAATGATGAATGTGTCCGTGTCGTTGGAGTTCTTGGGATGACTGGTATCGGCAAGACAACGGTTGCTGATATCGTATATAAACAGAACTTCCAGAGGTTTGATGGATACGAGTTCCTTGAAGACATTGAAGATAACTCTAAGCGGTATGGATTACCTTATTTGTACCAAAAACTCCTCCATAAATTATTGGATGGAGAAAATGTTGATGTCAGAGCGCAGGGAAGACCGGAAAACTTTCTAAGGAACAAGAAATTGTTTATTGTGCTGGACAATGTGACCGAAGAGAAACAAATAGAATATCTTATCGGAAAGAAGAATGTGTACAGGCAAGGAAGTAGGATTGTTATAATAACAAGAGACAAGAAACTGCTGCAGAAAAACGCTGATGCTACATATGTGGTTCCCAGATTAAATGACAGGGAAGCTATGGAGTTATTCTGCCTTCAGGTATTTGGCAACCACTATCCCACGGAAGAATTTGTGGATCTATCAAACGATTTTGTTTGTTATGCTAAAGGGCTTCCGTTAGCTTTGAAGTTGTTAGGTAAGGGTCTATTAACCCATGATATAAACTACTGGAAGAAGAAATTGGAGTTTTTACAGGTAAATCCAGACAAGGAGCTTCAGAAAGAGCTGAAATCGAGTTATAAAGCACTTGATGATGATCAGAAGAGCGTATTTCTGGACATAGCATGTTTTTTCAGGTCAGAGAAAGCAGATTTTGTTTCAAGCATTCTGAAATCAGACGACATTGATGCTAAAGATGTGATGAGAGAACTTGAGGAGAAGTGCCTTGTAACCATTTCTTACGATAGGATTGAGATGCATGATCTATTGCATGCAATGGGGAAGGAAATTGGAAAAGAAAAATCCATCAGAAAGGCAGGCGAACGTCGTAGGTTGTGGAACCACAAAGATATTCGTGATATCCTGGAGCATAACACGGGCACTGAATGTGTTAGAGGCATCTTCTTGAACATGTCTGAAGTCAGAAGAATCAAGCTTTTTCCTGCTGCTTTCACGATGTTGTCAAAACTCAAATTCCTGAAATTCCACAGTTCTCATTGTTCTCAGTGGTGTGATAATGACCATATATTTCAGTGCTCCAAAGTCCCTGATCACTTTCCAGATGAGCTTGTTTACCTTCACTGGCAGGGGTATCCCTATGATTGCCTGCCATCAGATTTCGATCCAAAGGAACTTGTCGATCTTAGTCTGCGTTATAGCCACATCAAACAACTGTGGGAAGATGAGAAGAATACAGAAAGTTTAAGATGGGTCGATCTCGGTCAGTCAAAAGACTTGCTAAATTTATCAGGTTTATCCAGGGCCAAAAATCTTGAAAGATTGGATCTTGAAGGCTGTACGAGTTTGGATCTCTTGGGCTCAGTAAAACAGATGAACGAACTTATTTACCTGAACCTCAGAGACTGCACAAGCCTTGAGAGTCTTCCAAAGGGATTCAAAATAAAATCTCTTAAGACTCTGATCCTCAGTGGTTGCTTAAAACTTAAGGACTTTCATATTATATCAGAAAGTATTGAATCCCTTCATTTGGAAGGCACAGCAATCGAACGAGTTGTTGAACACATCGAGAGTCTTCACAGCCTTATTTTGCTGAATCTCAAGAATTGTGAGAAATTGAAGTATCTTCCCAACGATCTTTACAAGCTGAAATCTCTCCAAGAACTGGTTCTCTCTGGTTGTTCAGCGCTGGAGAGTCTTCCGCCCATCAAAGAGAAGATGGAATGCTTAGAGATTTTGCTTATGGATGGAACGTCTATCAAACAAACACCTGAAATGAGTTGTTTGAGTAACCTCAAAATTTGTTCGTTCTGTCGACCTGTTATCGACGATTCCACAGGGTTGTACTTAGATGCTCATGGGTGTGGTTCTCTGGAAAATGTTTCAAAACCACTAACGATTCCTCTCGTAACCGAGAGGATGCATACTACTTTCATTTTTACGGATTGCTTCAAGCTGAACCAAGCGGAGAAGGAAGATATTGTAGCTCAGGCCCAACTCAAGAGTCAGTTACTGGCAAGGACATCTCGTCATCATAATCATAAGGGACTACTTCTGGATCCTCTGGTTGCCGTTTGCTTTCCAGGACATGACATACCCTCATGGTTCTCCCATCAAAAAATGGGATCTTTGATAGAAACCGACCTGCTTCCACACTGGTGTAACATCTTCAAATGGAGCGAAGAGACTAATGAAGGTAATAGATGTCATCCCACTAGTGCCTCATTCGAATTCTACCTTACTGATGAAACCGAAAGAAAACTAGAATGCTGCGAGATTTTAAGGTGTGGGATGAATTTTTTATATGCTCGAGATGAGAACGACCGTAAATTCCAGGGAATACGGGTTACAGACACTGTTGAGCGTACATCTAGTGAGGCTCTTGTAACCATTCGAGGTCAGTCCCACTCACGGATTGAAGAGAGAAGATATGGCAGAATAAGAGATGAAATCATGGATATGACTGGATCCTCCATGATAGGAGGTCCCGAGTCTTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MAFASSSSSIVLSKCEFDVFVSFRGADTRHDFTSHLVKYLRGKGIDVFSDAKLRGGEYISLLFDRIEQSKMSIVVFSEDYANSWWCLEEVGKIMQRRKEFNHGVLPIFYKVSKSDVSNQTGSFEAVFQSPTKIFNGDEQKIEELKVALKTASNIRGFVYPENSSEPDFLDEIVKNTFRMLNELSPCVIPDDLPGIESRSKELEKLLMFDNDECVRVVGVLGMTGIGKTTVADIVYKQNFQRFDGYEFLEDIEDNSKRYGLPYLYQKLLHKLLDGENVDVRAQGRPENFLRNKKLFIVLDNVTEEKQIEYLIGKKNVYRQGSRIVIITRDKKLLQKNADATYVVPRLNDREAMELFCLQVFGNHYPTEEFVDLSNDFVCYAKGLPLALKLLGKGLLTHDINYWKKKLEFLQVNPDKELQKELKSSYKALDDDQKSVFLDIACFFRSEKADFVSSILKSDDIDAKDVMRELEEKCLVTISYDRIEMHDLLHAMGKEIGKEKSIRKAGERRRLWNHKDIRDILEHNTGTECVRGIFLNMSEVRRIKLFPAAFTMLSKLKFLKFHSSHCSQWCDNDHIFQCSKVPDHFPDELVYLHWQGYPYDCLPSDFDPKELVDLSLRYSHIKQLWEDEKNTESLRWVDLGQSKDLLNLSGLSRAKNLERLDLEGCTSLDLLGSVKQMNELIYLNLRDCTSLESLPKGFKIKSLKTLILSGCLKLKDFHIISESIESLHLEGTAIERVVEHIESLHSLILLNLKNCEKLKYLPNDLYKLKSLQELVLSGCSALESLPPIKEKMECLEILLMDGTSIKQTPEMSCLSNLKICSFCRPVIDDSTGLYLDAHGCGSLENVSKPLTIPLVTERMHTTFIFTDCFKLNQAEKEDIVAQAQLKSQLLARTSRHHNHKGLLLDPLVAVCFPGHDIPSWFSHQKMGSLIETDLLPHWCNIFKWSEETNEGNRCHPTSASFEFYLTDETERKLECCEILRCGMNFLYARDENDRKFQGIRVTDTVERTSSEALVTIRGQSHSRIEERRYGRIRDEIMDMTGSSMIGGPES

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
5-157 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSSSIVLSKCEFDVFVSFRGADTRHDFTSHLVKYLRGKGIDVFSDAKLRGGEYISLLFDRIEQSKMSIVVFSEDYANSWWCLEEVGKIMQRRKEFNHGVLPIFYKVSKSDVSNQTGSFEAVFQSPTKIFNGDEQKIEELKVALKTASNIRGF

Gene3D: G3DSA:3.40.50.10140
14-143 G3DSA:3.40.50.10140

KCEFDVFVSFRGADTRHDFTSHLVKYLRGKGIDVFSDAKLRGGEYISLLFDRIEQSKMSIVVFSEDYANSWWCLEEVGKIMQRRKEFNHGVLPIFYKVSKSDVSNQTGSFEAVFQSPTKIFNGDEQKIEE

ProfileScan: PS50104
IPR000157
15-154 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CEFDVFVSFRGADTRHDFTSHLVKYLRGKGIDVFSDAKLRGGEYISLLFDRIEQSKMSIVVFSEDYANSWWCLEEVGKIMQRRKEFNHGVLPIFYKVSKSDVSNQTGSFEAVFQSPTKIFNGDEQKIEELKVALKTASNI

HMMSmart: SM00255
IPR000157
16-154 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EFDVFVSFRGADTRHDFTSHLVKYLRGKGIDVFSDAKLRGGEYISLLFDRIEQSKMSIVVFSEDYANSWWCLEEVGKIMQRRKEFNHGVLPIFYKVSKSDVSNQTGSFEAVFQSPTKIFNGDEQKIEELKVALKTASNI

HMMPfam: PF01582
IPR000157
19-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFVSFRGADTRHDFTSHLVKYLRGKGIDVFSDAKLRGGEYISLLFDRIEQSKMSIVVFSEDYANSWWCLEEVGKIMQRRKEFNHGVLPIFYKVSKSDVSNQTGSFEAVFQSPTKIFNGDEQKIEELKVALK

HMMPanther: PTHR23155:SF247
26-1038 PTHR23155:SF247,SUBFAMILY NOT NAMED

ADTRHDFTSHLVKYLRGKGIDVFSDAKLRGGEYISLLFDRIEQSKMSIVVFSEDYANSWWCLEEVGKIMQRRKEFNHGVLPIFYKVSKSDVSNQTGSFEAVFQSPTKIFNGDEQKIEELKVALKTASNIRGFVYPENSSEPDFLDEIVKNTFRMLNELSPCVIPDDLPGIESRSKELEKLLMFDNDECVRVVGVLGMTGIGKTTVADIVYKQNFQRFDGYEFLEDIEDNSKRYGLPYLYQKLLHKLLDGENVDVRAQGRPENFLRNKKLFIVLDNVTEEKQIEYLIGKKNVYRQGSRIVIITRDKKLLQKNADATYVVPRLNDREAMELFCLQVFGNHYPTEEFVDLSNDFVCYAKGLPLALKLLGKGLLTHDINYWKKKLEFLQVNPDKELQKELKSSYKALDDDQKSVFLDIACFFRSEKADFVSSILKSDDIDAKDVMRELEEKCLVTISYDRIEMHDLLHAMGKEIGKEKSIRKAGERRRLWNHKDIRDILEHNTGTECVRGIFLNMSEVRRIKLFPAAFTMLSKLKFLKFHSSHCSQWCDNDHIFQCSKVPDHFPDELVYLHWQGYPYDCLPSDFDPKELVDLSLRYSHIKQLWEDEKNTESLRWVDLGQSKDLLNLSGLSRAKNLERLDLEGCTSLDLLGSVKQMNELIYLNLRDCTSLESLPKGFKIKSLKTLILSGCLKLKDFHIISESIESLHLEGTAIERVVEHIESLHSLILLNLKNCEKLKYLPNDLYKLKSLQELVLSGCSALESLPPIKEKMECLEILLMDGTSIKQTPEMSCLSNLKICSFCRPVIDDSTGLYLDAHGCGSLENVSKPLTIPLVTERMHTTFIFTDCFKLNQAEKEDIVAQAQLKSQLLARTSRHHNHKGLLLDPLVAVCFPGHDIPSWFSHQKMGSLIETDLLPHWCNIFKWSEETNEGNRCHPTSASFEFYLTDETERKLECCEILRCGMNFLYARDENDRKFQGIRVTDTVERTSSEALVTIRGQSHSRIEERRYGRIRDEIMDM

HMMPanther: PTHR23155
26-1038 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ADTRHDFTSHLVKYLRGKGIDVFSDAKLRGGEYISLLFDRIEQSKMSIVVFSEDYANSWWCLEEVGKIMQRRKEFNHGVLPIFYKVSKSDVSNQTGSFEAVFQSPTKIFNGDEQKIEELKVALKTASNIRGFVYPENSSEPDFLDEIVKNTFRMLNELSPCVIPDDLPGIESRSKELEKLLMFDNDECVRVVGVLGMTGIGKTTVADIVYKQNFQRFDGYEFLEDIEDNSKRYGLPYLYQKLLHKLLDGENVDVRAQGRPENFLRNKKLFIVLDNVTEEKQIEYLIGKKNVYRQGSRIVIITRDKKLLQKNADATYVVPRLNDREAMELFCLQVFGNHYPTEEFVDLSNDFVCYAKGLPLALKLLGKGLLTHDINYWKKKLEFLQVNPDKELQKELKSSYKALDDDQKSVFLDIACFFRSEKADFVSSILKSDDIDAKDVMRELEEKCLVTISYDRIEMHDLLHAMGKEIGKEKSIRKAGERRRLWNHKDIRDILEHNTGTECVRGIFLNMSEVRRIKLFPAAFTMLSKLKFLKFHSSHCSQWCDNDHIFQCSKVPDHFPDELVYLHWQGYPYDCLPSDFDPKELVDLSLRYSHIKQLWEDEKNTESLRWVDLGQSKDLLNLSGLSRAKNLERLDLEGCTSLDLLGSVKQMNELIYLNLRDCTSLESLPKGFKIKSLKTLILSGCLKLKDFHIISESIESLHLEGTAIERVVEHIESLHSLILLNLKNCEKLKYLPNDLYKLKSLQELVLSGCSALESLPPIKEKMECLEILLMDGTSIKQTPEMSCLSNLKICSFCRPVIDDSTGLYLDAHGCGSLENVSKPLTIPLVTERMHTTFIFTDCFKLNQAEKEDIVAQAQLKSQLLARTSRHHNHKGLLLDPLVAVCFPGHDIPSWFSHQKMGSLIETDLLPHWCNIFKWSEETNEGNRCHPTSASFEFYLTDETERKLECCEILRCGMNFLYARDENDRKFQGIRVTDTVERTSSEALVTIRGQSHSRIEERRYGRIRDEIMDM

superfamily: SSF52540
175-417 SSF52540

NTFRMLNELSPCVIPDDLPGIESRSKELEKLLMFDNDECVRVVGVLGMTGIGKTTVADIVYKQNFQRFDGYEFLEDIEDNSKRYGLPYLYQKLLHKLLDGENVDVRAQGRPENFLRNKKLFIVLDNVTEEKQIEYLIGKKNVYRQGSRIVIITRDKKLLQKNADATYVVPRLNDREAMELFCLQVFGNHYPTEEFVDLSNDFVCYAKGLPLALKLLGKGLLTHDINYWKKKLEFLQVNPDKEL

Gene3D: G3DSA:3.40.50.300
180-333 G3DSA:3.40.50.300

LNELSPCVIPDDLPGIESRSKELEKLLMFDNDECVRVVGVLGMTGIGKTTVADIVYKQNFQRFDGYEFLEDIEDNSKRYGLPYLYQKLLHKLLDGENVDVRAQGRPENFLRNKKLFIVLDNVTEEKQIEYLIGKKNVYRQGSRIVIITRDKKLL

HMMPfam: PF00931
IPR002182
201-447 NB-ARC,NBS
NB-ARC

ELEKLLMFDNDECVRVVGVLGMTGIGKTTVADIVYKQNFQRFDGYEFLEDIEDNSKRYGLPYLYQKLLHKLLDGENVDVRAQGRPENFLRNKKLFIVLDNVTEEKQIEYLIGKKNVYRQGSRIVIITRDKKLLQKNADATYVVPRLNDREAMELFCLQVFGNHYPTEEFVDLSNDFVCYAKGLPLALKLLGKGLLTHDINYWKKKLEFLQVNPDKELQKELKSSYKALDDDQKSVFLDIACFFRSEK

FPrintScan: PR00364
IPR000767
216-231 DISEASERSIST
Disease resistance protein

VVGVLGMTGIGKTTVA

FPrintScan: PR00364
IPR000767
288-302 DISEASERSIST
Disease resistance protein

FLRNKKLFIVLDNVT

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

AKGLPLALKLLGKGL

superfamily: SSF46785
415-521 SSF46785

KELQKELKSSYKALDDDQKSVFLDIACFFRSEKADFVSSILKSDDIDAKDVMRELEEKCLVTISYDRIEMHDLLHAMGKEIGKEKSIRKAGERRRLWNHKDIRDILE

superfamily: SSF52058
483-818 SSF52058,LRR

EMHDLLHAMGKEIGKEKSIRKAGERRRLWNHKDIRDILEHNTGTECVRGIFLNMSEVRRIKLFPAAFTMLSKLKFLKFHSSHCSQWCDNDHIFQCSKVPDHFPDELVYLHWQGYPYDCLPSDFDPKELVDLSLRYSHIKQLWEDEKNTESLRWVDLGQSKDLLNLSGLSRAKNLERLDLEGCTSLDLLGSVKQMNELIYLNLRDCTSLESLPKGFKIKSLKTLILSGCLKLKDFHIISESIESLHLEGTAIERVVEHIESLHSLILLNLKNCEKLKYLPNDLYKLKSLQELVLSGCSALESLPPIKEKMECLEILLMDGTSIKQTPEMSCLSNLKI

Gene3D: G3DSA:3.80.10.10
579-816 G3DSA:3.80.10.10

KVPDHFPDELVYLHWQGYPYDCLPSDFDPKELVDLSLRYSHIKQLWEDEKNTESLRWVDLGQSKDLLNLSGLSRAKNLERLDLEGCTSLDLLGSVKQMNELIYLNLRDCTSLESLPKGFKIKSLKTLILSGCLKLKDFHIISESIESLHLEGTAIERVVEHIESLHSLILLNLKNCEKLKYLPNDLYKLKSLQELVLSGCSALESLPPIKEKMECLEILLMDGTSIKQTPEMSCLSNL

HMMPfam: PF07725
IPR011713
610-628 LRR_3
Leucine-rich repeat 3

LVDLSLRYSHIKQLWEDEK

HMMPfam: PF00560
IPR001611
679-697 LRR_1
Leucine-rich repeat

LIYLNLRDCTSLESLPKGF

FPrintScan: PR00364
IPR000767
765-781 DISEASERSIST
Disease resistance protein

YKLKSLQELVLSGCSAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox