PRGDB00047113 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18422526 (NM_123889)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G45210) mRNA, complete cds.

DNA Sequence

ATGGCGACTTCAAAGGCGGATGAAGTATTTATCGACTTCAGTGGAATCGAAACGCGCAATTCTTTTGTGAGTCATCTCTCGGCCGCTTTCCGCCGCAGGAGTGTTTCCGTTTGCCTTGGTGGAGACTGCACTGACGTGGTGACGCCGCGGAAAACCAATGAAGGGTGTAAAGTCTTTGTGGTGGTCTTCTCAGAGGATTACGCGTTGTCGAAACAGTGCTTAGATACACTCGTGGAGTTTCTGGAGCGAAAAGATGATGGGCTTGTGATTGTTCCGGTTTACTATGGTGGCGTCACTGAATCAATGGTGAAGCAACAGACGGAGAGATTCGGTGTAGCCTTTACCCAACATCAGAATAACTACTCGTACGACCAGGTAGCCAAATGGAGAGACTGTCTGATTCAAACGGCCAGCTTACCAGGTCATGAATTAAATCTTCAACAAGAAGACTCCGAATTTGTAGAAAAGATTGTTGCTGATGTACGTGAAGTGCTGGATGCAACAGGTAAGATCGGAATCTACTCGAGGCTGCTGGAGATAGAAAAATTGCTTTGCAAGCAATCTCTTAAATTCTATTACCTAGGGTTATGGGGTATGCCTGGCATAGGCAAGACCACCATTGCAGAAGCAGCCTTTAAGCAGATGTCTAAAGACTTTGATGCTTCGTTCTTTGTGGAAGACTTCCACAAAGAATATCATAAGGGACGTCCGTACAAACTGCGGGAAGAGCATTTGAAGAAGGTTCCGAAAGGTGGATCCATTAGGGGACCAATCCTCTCATTCAAAGAGTTACGCGAGAAGAAAGTTCTTTTTGTTCTTGATGATGTGCGCAACCTGATGGATTTCGAGTCTTTCCTTGGAGGAATTGAAGGGGTTAGCCCTGGAAGTGTAATAATCCTAACATCCAGAGATAAACAAGTTCTTCATCAGTGCCAGGTCGAGGATGTATTCGAAGTTCCGAGTCTGAACGAGGAAGAAGCTGTACGGTTATTCGCCCGGACCGCGTTCCATAAAGAAGGGCCAAGTGATGCTAAATTAATGGACGTATCAAAGAAGGTTGCTAGATATGCTGGTGGAAATCCTAAGGCTCTATGCTTCTATGGGAGAGAGCTGGAGAAGAAAAAGAAGCCGGAAGAAATGGAGGAGGAGTTTGAGAAGATGAGGCAATGTCCCCCCCAAGAAATACTCAGTTTATTCAGAAGCAGCTATGATGCACTTAACGACAATGAGAGAAGTATATTCTTGGACATTGCGTGTTTCTTTAATGGTGAACCGTGTGACGATGTAATGCGAATACTTGAAGGGTGTGGGTTCTTTCCACACGTTGGGATTGACCGTCTTGCTGAGCGGTCTCTACTGACGATCTCAAAGGAAAAAAGAGTGGAGATGCAAGGTTTTATTCAAGATGCTGCCCGTGAATTCATCAACCAGACTTCGAGGCGTCGCAGACACTGGGAACCATCAAGAATCAGATTATTACTAGAAAATGATAAATCTAAGGGGAATGAAGTTATTGAAGGGATTTTTCTTGACACAACAAAATTAACCTTTGATGTTAATCCTATGGCGTTTGAGAATATGTATAATCTTAGACTGTTGAAGATCTATAGTACACACTCCGAAACTGCTCAAGAACTTCGTCTTACTAAGGAACTTCGCTCTTTGCCTTATGAGCTCAGGCTACTCCACTGGGAGAAGTATCCGTTGCAATCGTTGCCTCAAGATTTTGACACTCGGCACCTTGTTGAACTCAATATGCCTTATAGTCAGCTTCAAAGTCTCTGTGTTGGAACTAAGAGCCTAGCCAAATTAAAGATGATAAATCTTAGCCACTCTCAGAAACTACTTGAAGTTGACGAACTCGCGAAAGCGTGTAATCTTGAGAAAATAGATCTTCAAGGTTGTACAAGCTTGAAGAGCATCCCACACACGGATCGGCTAAAGAATCTTCAATTTCTGAATCTATCTGGTTGCACGAGTATCAAACGTACGGAGGCTATAAAGAAGATAAAAGGAATGAATCAAGAAGGCTGCTTAAGAGAAACTACATTTGAATCAATGGTGTTCGAATACTATGTTAAAGAATCTTCTTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MATSKADEVFIDFSGIETRNSFVSHLSAAFRRRSVSVCLGGDCTDVVTPRKTNEGCKVFVVVFSEDYALSKQCLDTLVEFLERKDDGLVIVPVYYGGVTESMVKQQTERFGVAFTQHQNNYSYDQVAKWRDCLIQTASLPGHELNLQQEDSEFVEKIVADVREVLDATGKIGIYSRLLEIEKLLCKQSLKFYYLGLWGMPGIGKTTIAEAAFKQMSKDFDASFFVEDFHKEYHKGRPYKLREEHLKKVPKGGSIRGPILSFKELREKKVLFVLDDVRNLMDFESFLGGIEGVSPGSVIILTSRDKQVLHQCQVEDVFEVPSLNEEEAVRLFARTAFHKEGPSDAKLMDVSKKVARYAGGNPKALCFYGRELEKKKKPEEMEEEFEKMRQCPPQEILSLFRSSYDALNDNERSIFLDIACFFNGEPCDDVMRILEGCGFFPHVGIDRLAERSLLTISKEKRVEMQGFIQDAAREFINQTSRRRRHWEPSRIRLLLENDKSKGNEVIEGIFLDTTKLTFDVNPMAFENMYNLRLLKIYSTHSETAQELRLTKELRSLPYELRLLHWEKYPLQSLPQDFDTRHLVELNMPYSQLQSLCVGTKSLAKLKMINLSHSQKLLEVDELAKACNLEKIDLQGCTSLKSIPHTDRLKNLQFLNLSGCTSIKRTEAIKKIKGMNQEGCLRETTFESMVFEYYVKESS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
5-139 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KADEVFIDFSGIETRNSFVSHLSAAFRRRSVSVCLGGDCTDVVTPRKTNEGCKVFVVVFSEDYALSKQCLDTLVEFLERKDDGLVIVPVYYGGVTESMVKQQTERFGVAFTQHQNNYSYDQVAKWRDCLIQTASL

superfamily: SSF52200
IPR000157
9-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFIDFSGIETRNSFVSHLSAAFRRRSVSVCLGGDCTDVVTPRKTNEGCKVFVVVFSEDYALSKQCLDTLVEFLERKDDGLVIVPVYYGGVTESMVKQQTERFGVAFTQHQNNYSYDQVAKWRDCLIQTASLPGH

Gene3D: G3DSA:3.40.50.10140
9-130 G3DSA:3.40.50.10140

VFIDFSGIETRNSFVSHLSAAFRRRSVSVCLGGDCTDVVTPRKTNEGCKVFVVVFSEDYALSKQCLDTLVEFLERKDDGLVIVPVYYGGVTESMVKQQTERFGVAFTQHQNNYSYDQVAKWR

HMMPfam: PF01582
IPR000157
9-132 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFIDFSGIETRNSFVSHLSAAFRRRSVSVCLGGDCTDVVTPRKTNEGCKVFVVVFSEDYALSKQCLDTLVEFLERKDDGLVIVPVYYGGVTESMVKQQTERFGVAFTQHQNNYSYDQVAKWRDC

HMMPfam: PF00931
IPR002182
180-438 NB-ARC,NBS
NB-ARC

IEKLLCKQSLKFYYLGLWGMPGIGKTTIAEAAFKQMSKDFDASFFVEDFHKEYHKGRPYKLREEHLKKVPKGGSIRGPILSFKELREKKVLFVLDDVRNLMDFESFLGGIEGVSPGSVIILTSRDKQVLHQCQVEDVFEVPSLNEEEAVRLFARTAFHKEGPSDAKLMDVSKKVARYAGGNPKALCFYGRELEKKKKPEEMEEEFEKMRQCPPQEILSLFRSSYDALNDNERSIFLDIACFFNGEPCDDVMRILEGCGF

FPrintScan: PR00364
IPR000767
193-208 DISEASERSIST
Disease resistance protein

YLGLWGMPGIGKTTIA

superfamily: SSF52540
194-395 SSF52540

LGLWGMPGIGKTTIAEAAFKQMSKDFDASFFVEDFHKEYHKGRPYKLREEHLKKVPKGGSIRGPILSFKELREKKVLFVLDDVRNLMDFESFLGGIEGVSPGSVIILTSRDKQVLHQCQVEDVFEVPSLNEEEAVRLFARTAFHKEGPSDAKLMDVSKKVARYAGGNPKALCFYGRELEKKKKPEEMEEEFEKMRQCPPQEI

HMMPanther: PTHR11017:SF20
195-667 PTHR11017:SF20,SUBFAMILY NOT NAMED

GLWGMPGIGKTTIAEAAFKQMSKDFDASFFVEDFHKEYHKGRPYKLREEHLKKVPKGGSIRGPILSFKELREKKVLFVLDDVRNLMDFESFLGGIEGVSPGSVIILTSRDKQVLHQCQVEDVFEVPSLNEEEAVRLFARTAFHKEGPSDAKLMDVSKKVARYAGGNPKALCFYGRELEKKKKPEEMEEEFEKMRQCPPQEILSLFRSSYDALNDNERSIFLDIACFFNGEPCDDVMRILEGCGFFPHVGIDRLAERSLLTISKEKRVEMQGFIQDAAREFINQTSRRRRHWEPSRIRLLLENDKSKGNEVIEGIFLDTTKLTFDVNPMAFENMYNLRLLKIYSTHSETAQELRLTKELRSLPYELRLLHWEKYPLQSLPQDFDTRHLVELNMPYSQLQSLCVGTKSLAKLKMINLSHSQKLLEVDELAKACNLEKIDLQGCTSLKSIPHTDRLKNLQFLNLSGCTSIKRTEAI

HMMPanther: PTHR11017
195-667 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GLWGMPGIGKTTIAEAAFKQMSKDFDASFFVEDFHKEYHKGRPYKLREEHLKKVPKGGSIRGPILSFKELREKKVLFVLDDVRNLMDFESFLGGIEGVSPGSVIILTSRDKQVLHQCQVEDVFEVPSLNEEEAVRLFARTAFHKEGPSDAKLMDVSKKVARYAGGNPKALCFYGRELEKKKKPEEMEEEFEKMRQCPPQEILSLFRSSYDALNDNERSIFLDIACFFNGEPCDDVMRILEGCGFFPHVGIDRLAERSLLTISKEKRVEMQGFIQDAAREFINQTSRRRRHWEPSRIRLLLENDKSKGNEVIEGIFLDTTKLTFDVNPMAFENMYNLRLLKIYSTHSETAQELRLTKELRSLPYELRLLHWEKYPLQSLPQDFDTRHLVELNMPYSQLQSLCVGTKSLAKLKMINLSHSQKLLEVDELAKACNLEKIDLQGCTSLKSIPHTDRLKNLQFLNLSGCTSIKRTEAI

Gene3D: G3DSA:3.40.50.300
196-387 G3DSA:3.40.50.300

LWGMPGIGKTTIAEAAFKQMSKDFDASFFVEDFHKEYHKGRPYKLREEHLKKVPKGGSIRGPILSFKELREKKVLFVLDDVRNLMDFESFLGGIEGVSPGSVIILTSRDKQVLHQCQVEDVFEVPSLNEEEAVRLFARTAFHKEGPSDAKLMDVSKKVARYAGGNPKALCFYGRELEKKKKPEEMEEEFEKM

FPrintScan: PR00364
IPR000767
263-277 DISEASERSIST
Disease resistance protein

ELREKKVLFVLDDVR

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

AGGNPKALCFYGREL

superfamily: SSF46785
393-495 SSF46785

QEILSLFRSSYDALNDNERSIFLDIACFFNGEPCDDVMRILEGCGFFPHVGIDRLAERSLLTISKEKRVEMQGFIQDAAREFINQTSRRRRHWEPSRIRLLLE

superfamily: SSF52058
462-658 SSF52058,LRR

EMQGFIQDAAREFINQTSRRRRHWEPSRIRLLLENDKSKGNEVIEGIFLDTTKLTFDVNPMAFENMYNLRLLKIYSTHSETAQELRLTKELRSLPYELRLLHWEKYPLQSLPQDFDTRHLVELNMPYSQLQSLCVGTKSLAKLKMINLSHSQKLLEVDELAKACNLEKIDLQGCTSLKSIPHTDRLKNLQFLNLSGC

Gene3D: G3DSA:3.80.10.10
506-669 G3DSA:3.80.10.10

EGIFLDTTKLTFDVNPMAFENMYNLRLLKIYSTHSETAQELRLTKELRSLPYELRLLHWEKYPLQSLPQDFDTRHLVELNMPYSQLQSLCVGTKSLAKLKMINLSHSQKLLEVDELAKACNLEKIDLQGCTSLKSIPHTDRLKNLQFLNLSGCTSIKRTEAIKK

FPrintScan: PR00364
IPR000767
599-615 DISEASERSIST
Disease resistance protein

KSLAKLKMINLSHSQKL

HMMPfam: PF00560
IPR001611
626-643 LRR_1
Leucine-rich repeat

NLEKIDLQGCTSLKSIPH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox