PRGDB00047114 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30694678 (NM_123874)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G45060) mRNA, complete cds.

DNA Sequence

ATGGCGGCCTCCTCTTCCTCCACCGGTCTCCCACCACAACATCAAGTATTCATCAATTTCCGTGGAGAAGATTTACGACTCGGATTCGTAAGCCATCTAGTAGAAGCTTTAGAAAACGATAACATAAAAGTCTTCATCGACAACTACGCAGACAAAGGCGAACCTTTAGAAACACTTTTAACCAAGATACATGACTCCAAAATCGCTCTAGCTATCTTCTCCGGGAAGTACACTGAATCAACATGGTGCTTGAGAGAGCTAGCGATGATAAAAGATTGTGTGGAGAAAGGTAAACTTGTTGCTATTCCTATCTTCTACAAGGTAGATCCATCCACTGTTAGAGGTGTTAGAGGGCAGTTCGGTGATGCTTTTAGAGATCTTGAGGAACGTGATGTGATTAAGAAGAAAGAGTGGAAACAAGCTTTGAAGTGGATTCCTGGCTTAATTGGTATCACTGTTCACGATAAAAGTCCTGAGAGTGAAATACTCAACGAAATCGTTAAGGAGGTTAAGAAAGTGTTGAAGAAAGTTTCATTGGAGGGAAGCCAAAAGGTGGTCTCTGTGGATCCATCACAAAGTATTGACACTCTAAGTTCGGTAGGAGGTGAAAAGGATAAGACTTTTGGAATCAAACAACGGTTGAAGGAGTTGGAAGAGAAGTTGGATCTTGTTAAATACAAGGGAACTCGTGTCATTGGAGTTGTTGGGATGCCTGGAATTGGCAAAACCACACTGGTGAAAGAGCTCTATAAGACCTGGCAGGGCAAGTTTTCGAGGTATGCGTTGATCGATCAAATCCGTGGGAAGTCAAATAACTTCAGGTTAGAGTGCTTGCCTACTTTGCTTTTAGAGAAGCTACTACCGGAGTTGAATAATCCTCAACTAGATAGTATTGAAGAACCATACAAAACTCATAAGGGTCTACTGCGTGAACGCAAAGTTCTCGTCGTCCTTGATGATGTTAGTAGAAGGGAACAAATATATGCTCTTCTTGGGAAATATGATCTTCACAGTAAACATGAGTGGATCAAAGATGGCAGCAGGATCATCATTGCAACGAACGATATCTCCTCATTGAAGGGTCTCGTTCATGACACTTATGTGGTTCGGCAATTAAACCACAGAGACGGCTTACAACTTTTTCGCTATCACGCCTTTCATTATGATCAAGCCACTCCTCCAAAGGTGGATTTCATGAAGCTTTCTGATGAGTTTGTGCATTATGCTAGAGGCCATCCACTAGCTCTCAAAATATTGGGTAGAGAGCTTTATGAGAAAAATATGAAGCATTGGGAAACAAAACTGATAATACTTGCTCAAAGTCCCACCACTTATATTGGAGAAGTCGTGCAAGTAAGTTATGATGAATTGAGTTTGGCGCAGAAAGATGCATTTCTCGACATAGCTTGTTTCAGATCACAGGATGTGGATTATGTAGAAAGTTTACTGGTTTCGTCTGACCCTGGATCTGCTGAAGCAATAAAAGCTCTCAAGAATAAGTTCTTGATTGATACATGTGACGGCCGTGTGGAGATGCATGATCTACTGTATAGATTTTCTAGGGAACTTGATCTTAAAGCATCCACTCAAGGTGGTAGCAAACAACGAAGGTTATGGGTCCGTCAAGACATAATTAATGTACAGCAGAAAACAATGGGAGCTGCAAATGTTAGAGGTATTTTCCTAGATTTGTCTGAAGTGAAGGTTGAAACAAGCTTAGACCGTGAACACTTCAAGAATATGCGCAATCTCCGGTATCTCAAGTTATACAATTCACATTGCCCTCACGAATGTCTAACCAATAATAAGATAAACATGCCTGATGGACTTGAGCTACCATTGAAAGAGGTTCGATGCCTTCACTGGCTGAAATTCCCATTAGAGGAACTTCCAAACGATTTTGACCCGATTAATCTCGTCGACCTTAAGCTGCCATACAGTGAGATTGAACGACTTTGGGATGGTGTTAAGGATACACCAGTCTTAAAATGGGTCGATCTCAATCACTCAAGTAAGTTGTGCAGCTTGTCAGGATTATCAAAGGCTCAAAATCTTCAAAGACTGAACCTTGAAGGGTGCACAAGTCTTGAATCTCTTCGAGATGTGAATTTGACGTCTTTGAAAACTCTCACCCTCAGCAACTGCTCAAACTTCAAGGAATTTCCATTGATTCCAGAAAATTTAAAAGCTTTATACTTGGACGGGACATCGATAAGTCAACTTCCTGACAACGTGGGGAACCTCAAAAGACTTGTCTTATTGAATATGAAGGACTGCAAAGTGCTGGAGACTATCCCTACCTGTGTTAGTGAGCTGAAAACTCTTCAAAAACTTGTACTTTCAGGTTGTTCAAAGCTCAAGGAATTTCCAGAAATCAACAAGAGCTCTTTAAAAATTTTACTTCTAGATGGGACATCCATCAAAACGATGCCGCAGTTACCCTCAGTACAGTATTTATGCTTAAGCAGAAATGATCATCTCATCTACCTTCCAGCTGGCATCAATCAAGTTTCTCAGTTAACACGGCTGGATTTGAAGTATTGTACGAAGCTTACATATGTTCCAGAGTTGCCACCAACTCTCCAGTACTTAGATGCACATGGCTGTAGCTCACTGAAGAATGTTGCAAAACCACTGGCCCGTATCATGTCAACCGTGCAGAACCATTACACTTTCAATTTCACCAACTGTGGTAACCTGGAGCAAGCTGCAAAGGAGGAAATCACATCGTATGCTCAAAGAAAATGTCAGTTGCTGTCAGATGCACGTAAACACTACAATGAGGGTTCAGAGGCTTTGTTCAGCACTTGCTTTCCTGGATGTGAGGTGCCTTCGTGGTTTGGTCATGAAGCGGTTGGATCTCTGTTGCAAAGAAAACTCCTCCCACATTGGCATGACAAGAGGCTTTCTGGAATAGCTCTATGTGCTGTAGTCTCATTTCCTGACAGCCAAGATCAACTCAGCTGCTTCTCGGTGACATGCACCTTTAAAATAAAAGCTGAAGACAAGTCTTGGGTCCCCTTTACTTGCCCGGTAGGAATTTGGACTAGAGAGGGAAACAAGAAAGACAGGATTGAGTCGGATCATGTTTTCATAGCCTACATTAGTAGCCCACATTCAATAAGGTGTCTCGAAGAGAAGAACTCTGATAAATGCAATTTTAGTGAAGCCTCCCTTGAGTTTACGGTGACAAGTGATACAAGTGGTATTGGAGTATTCAAGGTTTTGAAGTGTGGATTGAGTTTGGTGTATGAAAATGACAAAAACAAAAACAGTTCTCTTGAGGCAAAGTATGATGTTCCTGTTGAAGTGAGCTTTCAAGAACCAGAACACGGGATAATGGAGGAGGAGAGATATATAAACAAAAGAAGAAGTGATGATAGACGACCAAAAAAGAAGAGGAAGACAAAAAGGGATGATATTATGATAATATCCACTGTCACTCAAACTTGTGTTCCAAGTGTAAATGCAAGAATAGAAGATAAAGTCACTGGTTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MAASSSSTGLPPQHQVFINFRGEDLRLGFVSHLVEALENDNIKVFIDNYADKGEPLETLLTKIHDSKIALAIFSGKYTESTWCLRELAMIKDCVEKGKLVAIPIFYKVDPSTVRGVRGQFGDAFRDLEERDVIKKKEWKQALKWIPGLIGITVHDKSPESEILNEIVKEVKKVLKKVSLEGSQKVVSVDPSQSIDTLSSVGGEKDKTFGIKQRLKELEEKLDLVKYKGTRVIGVVGMPGIGKTTLVKELYKTWQGKFSRYALIDQIRGKSNNFRLECLPTLLLEKLLPELNNPQLDSIEEPYKTHKGLLRERKVLVVLDDVSRREQIYALLGKYDLHSKHEWIKDGSRIIIATNDISSLKGLVHDTYVVRQLNHRDGLQLFRYHAFHYDQATPPKVDFMKLSDEFVHYARGHPLALKILGRELYEKNMKHWETKLIILAQSPTTYIGEVVQVSYDELSLAQKDAFLDIACFRSQDVDYVESLLVSSDPGSAEAIKALKNKFLIDTCDGRVEMHDLLYRFSRELDLKASTQGGSKQRRLWVRQDIINVQQKTMGAANVRGIFLDLSEVKVETSLDREHFKNMRNLRYLKLYNSHCPHECLTNNKINMPDGLELPLKEVRCLHWLKFPLEELPNDFDPINLVDLKLPYSEIERLWDGVKDTPVLKWVDLNHSSKLCSLSGLSKAQNLQRLNLEGCTSLESLRDVNLTSLKTLTLSNCSNFKEFPLIPENLKALYLDGTSISQLPDNVGNLKRLVLLNMKDCKVLETIPTCVSELKTLQKLVLSGCSKLKEFPEINKSSLKILLLDGTSIKTMPQLPSVQYLCLSRNDHLIYLPAGINQVSQLTRLDLKYCTKLTYVPELPPTLQYLDAHGCSSLKNVAKPLARIMSTVQNHYTFNFTNCGNLEQAAKEEITSYAQRKCQLLSDARKHYNEGSEALFSTCFPGCEVPSWFGHEAVGSLLQRKLLPHWHDKRLSGIALCAVVSFPDSQDQLSCFSVTCTFKIKAEDKSWVPFTCPVGIWTREGNKKDRIESDHVFIAYISSPHSIRCLEEKNSDKCNFSEASLEFTVTSDTSGIGVFKVLKCGLSLVYENDKNKNSSLEAKYDVPVEVSFQEPEHGIMEEERYINKRRSDDRRPKKKRKTKRDDIMIISTVTQTCVPSVNARIEDKVTG

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AASSSSTGLPPQHQVFINFRGEDLRLGFVSHLVEALENDNIKVFIDNYADKGEPLETLLTKIHDSKIALAIFSGKYTESTWCLRELAMIKDCVEKGKLVAIPIFYKVDPSTVRGVRGQFGDAFRDLEERDVIKKKEWKQALKWIPGLIGI

ProfileScan: PS50104
IPR000157
12-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PQHQVFINFRGEDLRLGFVSHLVEALENDNIKVFIDNYADKGEPLETLLTKIHDSKIALAIFSGKYTESTWCLRELAMIKDCVEKGKLVAIPIFYKVDPSTVRGVRGQFGDAFRDLEERDVIKKKEWKQALKWIPGL

HMMSmart: SM00255
IPR000157
13-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QHQVFINFRGEDLRLGFVSHLVEALENDNIKVFIDNYADKGEPLETLLTKIHDSKIALAIFSGKYTESTWCLRELAMIKDCVEKGKLVAIPIFYKVDPSTVRGVRGQFGDAFRDLEERDVIKKKEWKQALKWIPGL

Gene3D: G3DSA:3.40.50.10140
13-137 G3DSA:3.40.50.10140

QHQVFINFRGEDLRLGFVSHLVEALENDNIKVFIDNYADKGEPLETLLTKIHDSKIALAIFSGKYTESTWCLRELAMIKDCVEKGKLVAIPIFYKVDPSTVRGVRGQFGDAFRDLEERDVIKKKE

HMMPfam: PF01582
IPR000157
16-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFINFRGEDLRLGFVSHLVEALENDNIKVFIDNYADKGEPLETLLTKIHDSKIALAIFSGKYTESTWCLRELAMIKDCVEKGKLVAIPIFYKVDPSTVRGVRGQFGDAFRDLEERDVIKKKEWKQALK

HMMPanther: PTHR11017
57-1165 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ETLLTKIHDSKIALAIFSGKYTESTWCLRELAMIKDCVEKGKLVAIPIFYKVDPSTVRGVRGQFGDAFRDLEERDVIKKKEWKQALKWIPGLIGITVHDKSPESEILNEIVKEVKKVLKKVSLEGSQKVVSVDPSQSIDTLSSVGGEKDKTFGIKQRLKELEEKLDLVKYKGTRVIGVVGMPGIGKTTLVKELYKTWQGKFSRYALIDQIRGKSNNFRLECLPTLLLEKLLPELNNPQLDSIEEPYKTHKGLLRERKVLVVLDDVSRREQIYALLGKYDLHSKHEWIKDGSRIIIATNDISSLKGLVHDTYVVRQLNHRDGLQLFRYHAFHYDQATPPKVDFMKLSDEFVHYARGHPLALKILGRELYEKNMKHWETKLIILAQSPTTYIGEVVQVSYDELSLAQKDAFLDIACFRSQDVDYVESLLVSSDPGSAEAIKALKNKFLIDTCDGRVEMHDLLYRFSRELDLKASTQGGSKQRRLWVRQDIINVQQKTMGAANVRGIFLDLSEVKVETSLDREHFKNMRNLRYLKLYNSHCPHECLTNNKINMPDGLELPLKEVRCLHWLKFPLEELPNDFDPINLVDLKLPYSEIERLWDGVKDTPVLKWVDLNHSSKLCSLSGLSKAQNLQRLNLEGCTSLESLRDVNLTSLKTLTLSNCSNFKEFPLIPENLKALYLDGTSISQLPDNVGNLKRLVLLNMKDCKVLETIPTCVSELKTLQKLVLSGCSKLKEFPEINKSSLKILLLDGTSIKTMPQLPSVQYLCLSRNDHLIYLPAGINQVSQLTRLDLKYCTKLTYVPELPPTLQYLDAHGCSSLKNVAKPLARIMSTVQNHYTFNFTNCGNLEQAAKEEITSYAQRKCQLLSDARKHYNEGSEALFSTCFPGCEVPSWFGHEAVGSLLQRKLLPHWHDKRLSGIALCAVVSFPDSQDQLSCFSVTCTFKIKAEDKSWVPFTCPVGIWTREGNKKDRIESDHVFIAYISSPHSIRCLEEKNSDKCNFSEASLEFTVTSDTSGIGVFKVLKCGLSLVYENDKNKNSSLEAKYDVPVEVSFQEPEHGIMEEERYINKRRSDDRRPKKKRKTKRDDIMIISTVTQTCVPSVNARIEDKVTG

HMMPanther: PTHR11017:SF20
57-1165 PTHR11017:SF20,SUBFAMILY NOT NAMED

ETLLTKIHDSKIALAIFSGKYTESTWCLRELAMIKDCVEKGKLVAIPIFYKVDPSTVRGVRGQFGDAFRDLEERDVIKKKEWKQALKWIPGLIGITVHDKSPESEILNEIVKEVKKVLKKVSLEGSQKVVSVDPSQSIDTLSSVGGEKDKTFGIKQRLKELEEKLDLVKYKGTRVIGVVGMPGIGKTTLVKELYKTWQGKFSRYALIDQIRGKSNNFRLECLPTLLLEKLLPELNNPQLDSIEEPYKTHKGLLRERKVLVVLDDVSRREQIYALLGKYDLHSKHEWIKDGSRIIIATNDISSLKGLVHDTYVVRQLNHRDGLQLFRYHAFHYDQATPPKVDFMKLSDEFVHYARGHPLALKILGRELYEKNMKHWETKLIILAQSPTTYIGEVVQVSYDELSLAQKDAFLDIACFRSQDVDYVESLLVSSDPGSAEAIKALKNKFLIDTCDGRVEMHDLLYRFSRELDLKASTQGGSKQRRLWVRQDIINVQQKTMGAANVRGIFLDLSEVKVETSLDREHFKNMRNLRYLKLYNSHCPHECLTNNKINMPDGLELPLKEVRCLHWLKFPLEELPNDFDPINLVDLKLPYSEIERLWDGVKDTPVLKWVDLNHSSKLCSLSGLSKAQNLQRLNLEGCTSLESLRDVNLTSLKTLTLSNCSNFKEFPLIPENLKALYLDGTSISQLPDNVGNLKRLVLLNMKDCKVLETIPTCVSELKTLQKLVLSGCSKLKEFPEINKSSLKILLLDGTSIKTMPQLPSVQYLCLSRNDHLIYLPAGINQVSQLTRLDLKYCTKLTYVPELPPTLQYLDAHGCSSLKNVAKPLARIMSTVQNHYTFNFTNCGNLEQAAKEEITSYAQRKCQLLSDARKHYNEGSEALFSTCFPGCEVPSWFGHEAVGSLLQRKLLPHWHDKRLSGIALCAVVSFPDSQDQLSCFSVTCTFKIKAEDKSWVPFTCPVGIWTREGNKKDRIESDHVFIAYISSPHSIRCLEEKNSDKCNFSEASLEFTVTSDTSGIGVFKVLKCGLSLVYENDKNKNSSLEAKYDVPVEVSFQEPEHGIMEEERYINKRRSDDRRPKKKRKTKRDDIMIISTVTQTCVPSVNARIEDKVTG

Gene3D: G3DSA:3.40.50.300
204-364 G3DSA:3.40.50.300

KDKTFGIKQRLKELEEKLDLVKYKGTRVIGVVGMPGIGKTTLVKELYKTWQGKFSRYALIDQIRGKSNNFRLECLPTLLLEKLLPELNNPQLDSIEEPYKTHKGLLRERKVLVVLDDVSRREQIYALLGKYDLHSKHEWIKDGSRIIIATNDISSLKGLVH

superfamily: SSF52540
205-449 SSF52540

DKTFGIKQRLKELEEKLDLVKYKGTRVIGVVGMPGIGKTTLVKELYKTWQGKFSRYALIDQIRGKSNNFRLECLPTLLLEKLLPELNNPQLDSIEEPYKTHKGLLRERKVLVVLDDVSRREQIYALLGKYDLHSKHEWIKDGSRIIIATNDISSLKGLVHDTYVVRQLNHRDGLQLFRYHAFHYDQATPPKVDFMKLSDEFVHYARGHPLALKILGRELYEKNMKHWETKLIILAQSPTTYIGEV

HMMPfam: PF00931
IPR002182
211-474 NB-ARC,NBS
NB-ARC

KQRLKELEEKLDLVKYKGTRVIGVVGMPGIGKTTLVKELYKTWQGKFSRYALIDQIRGKSNNFRLECLPTLLLEKLLPELNNPQLDSIEEPYKTHKGLLRERKVLVVLDDVSRREQIYALLGKYDLHSKHEWIKDGSRIIIATNDISSLKGLVHDTYVVRQLNHRDGLQLFRYHAFHYDQATPPKVDFMKLSDEFVHYARGHPLALKILGRELYEKNMKHWETKLIILAQSPTTYIGEVVQVSYDELSLAQKDAFLDIACFRSQ

HMMSmart: SM00382
IPR003593
228-378 AAA,NBS
AAA+ ATPase domain

GTRVIGVVGMPGIGKTTLVKELYKTWQGKFSRYALIDQIRGKSNNFRLECLPTLLLEKLLPELNNPQLDSIEEPYKTHKGLLRERKVLVVLDDVSRREQIYALLGKYDLHSKHEWIKDGSRIIIATNDISSLKGLVHDTYVVRQLNHRDGL

FPrintScan: PR00364
IPR000767
231-246 DISEASERSIST
Disease resistance protein

VIGVVGMPGIGKTTLV

FPrintScan: PR00364
IPR000767
308-322 DISEASERSIST
Disease resistance protein

LLRERKVLVVLDDVS

FPrintScan: PR00364
IPR000767
409-423 DISEASERSIST
Disease resistance protein

ARGHPLALKILGREL

superfamily: SSF46785
444-549 SSF46785

TYIGEVVQVSYDELSLAQKDAFLDIACFRSQDVDYVESLLVSSDPGSAEAIKALKNKFLIDTCDGRVEMHDLLYRFSRELDLKASTQGGSKQRRLWVRQDIINVQQ

Gene3D: G3DSA:3.80.10.10
562-709 G3DSA:3.80.10.10

LDLSEVKVETSLDREHFKNMRNLRYLKLYNSHCPHECLTNNKINMPDGLELPLKEVRCLHWLKFPLEELPNDFDPINLVDLKLPYSEIERLWDGVKDTPVLKWVDLNHSSKLCSLSGLSKAQNLQRLNLEGCTSLESLRDVNLTSLKT

superfamily: SSF52058
569-888 SSF52058,LRR

VETSLDREHFKNMRNLRYLKLYNSHCPHECLTNNKINMPDGLELPLKEVRCLHWLKFPLEELPNDFDPINLVDLKLPYSEIERLWDGVKDTPVLKWVDLNHSSKLCSLSGLSKAQNLQRLNLEGCTSLESLRDVNLTSLKTLTLSNCSNFKEFPLIPENLKALYLDGTSISQLPDNVGNLKRLVLLNMKDCKVLETIPTCVSELKTLQKLVLSGCSKLKEFPEINKSSLKILLLDGTSIKTMPQLPSVQYLCLSRNDHLIYLPAGINQVSQLTRLDLKYCTKLTYVPELPPTLQYLDAHGCSSLKNVAKPLARIMSTVQN

HMMPfam: PF07725
IPR011713
638-657 LRR_3
Leucine-rich repeat 3

NLVDLKLPYSEIERLWDGVK

FPrintScan: PR00364
IPR000767
702-718 DISEASERSIST
Disease resistance protein

VNLTSLKTLTLSNCSNF

HMMPfam: PF13504
705-722 LRR_7,Leucine rich repeat

TSLKTLTLSNCSNFKEFP

Gene3D: G3DSA:3.80.10.10
710-890 G3DSA:3.80.10.10

LTLSNCSNFKEFPLIPENLKALYLDGTSISQLPDNVGNLKRLVLLNMKDCKVLETIPTCVSELKTLQKLVLSGCSKLKEFPEINKSSLKILLLDGTSIKTMPQLPSVQYLCLSRNDHLIYLPAGINQVSQLTRLDLKYCTKLTYVPELPPTLQYLDAHGCSSLKNVAKPLARIMSTVQNHY

HMMPfam: PF13504
774-790 LRR_7,Leucine rich repeat

TLQKLVLSGCSKLKEFP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox