PRGDB00047116 (disease resistance protein (TIR-NBS class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145359026 (NM_124255)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS class), putative (AT5G48780) mRNA, complete cds.

DNA Sequence

ATGTCTTCCTCTTCTTCCTCTTCCAGTCAGAAATTCTACGTTTTTCTGAGCTTCCAAGGCCTGGACACCCGTAGAACCTTTGTCAGCCATCTCCGCCGTTCATTGGACAGAAAAGGCATTAAGACTTTTGAAGATGAAAATGAGTCTCTGAGAGGTGAATTAGATTCTTCTGCGGTCTATCAGACAATTGGAGAGTCAAAAGTGGCCGTTGTCTTGATATCGGTGAACTATGCCTCTTCACCTTTGTGCCTGGATAGTCTCCTTAAGATTTTGAAGTTTCACCAGTCAGGTTCACTCGTTTTGATACCAATCTTCTATGAAGTTGATCCTATGGATGTAAGAAAACAAATTGGGAAACTGTACGAAGCATTCTCATTGCATGAGAGAGAAAACCCTGAAAAGGTTCAAACATGGAGGCAAGCACTGTCCCAACTGGTCAGCATTCCGGGCGGCCAGTACTCAGAGATTTGGGATGGTGATGCAGAGCTGATCCATCAAATTACCGTTGACATATGGAATATATTTGTCGCTTCCAAGTCAAGTGATTTGTGTGGTCTTGTGGGGATGGATCGCCACATGAAAGCCATGTATAGATTGTTAGATTTAGGATTGAAAGATGAAGTTCGTCATATCAAAATTTGGGGTAGCCGAGACATCGGCAAGACTGAGTTTGCAAAATATCTGTATGAAGAGATTTTGCACAACTTTGATACCCATGTCATGTTAAAAGCTCCACAAAGAATTTCGCGTTTTGAGGAGGTTCGTTTGGCAGAATATGTGTGTCTTCGACTTGAGAAAGCAAGAACTTTGTCAAAAACATCGAAGGACACTGCATCAAGGTTTCTCCTCGTACTGGATAATGTGAATGAATCATTTGACCCAATAAGAAAACTTGCAAGGGTGATTAGTTCTTTTGGTCCAGGGAGCAGGATCATTACAACCACCCGAAACTTGCAGTTCAGTTCGACTTCCCCTTTACCGTTTCAATATGAAGTTTTAGGGCTGGAGTTCTCTGAAGCTCTTCAGCTCTTCTGTCTCCATGCTTTCGAGCAGACTCATCCTTTTCTTGGTTTTGAAGACCTTTCATGTCGTGCAGTGAAACTCGCAGGTGGTTTTCCTTTATCCTTAAAAAGATTAGGCTCCAGATTTTCTGGTAGAAAGAAGGATGAATGGGAAGTGATCTTGTTTGGATACGAAAGATCAACTGTTAACGGTGTTATAAATCCCGAAAAAAATAGCCTGGATGGGCTATACGAATACAGCTCTATCATGGAAACTTTTTCAAGTCAACCGATTTCAAGCACAACAAGAAGTTTTGAAGACCTTGTGGGGATGAATCATCGTATGCAAGCTTTGTCGGCATTGTTAGAGCTAGAATCCGACAAAGAAGTTCGTGTAGTTGGAATTTGGGGTACAGGAGGCATTGGTAAAACAACTCTATCAAGATATGCTTACGAGAGAATCTCGCAGCAATTCCACACCCATGCTTTTCTAGAAAATGCTCAAGAGAGCAGTTCATCCTGTCTAGAAGAACGGTTTCTATCCAAAGCTATCCAAAGAGAAGCGCTTGCAGTAAGGAACTCTAAAGACTGTCCAGAAATAATGAAATCATTGATTCAACACCGAAAAGTTCTGCTTATAGTTGATGATGTGGATAACGTCAAGACGTTAGAGGAAGTCTTCAAGATCACCAGTTGGTTGGTCCCTGGAAGTAGAGTTATTGTGACTGCACGAGATGAGAGTTTTCTTCTGGCCAGTGGAGTGAAATATATTTTTGAAGTTAAGGGCCTGAGATTTGACCAAGCTCTTCAACTTTTCTATCAATTCGCTTTCAAGCAGAAATCACCTCCGGTTCGGTTCAGACAGCTATCAGTTCGGGCAATCAAGCTTGTTGGATTTCTCCCCTTAGCCCTTAAAGTGACCGGCTCAATGTTATATCGTAAAAAAGAATCCTACTGGGAAACTATATTGCAGTGTTTTGAAGAAAAGCAGAATAAAGGTACAATTTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS class), putative disease resistance protein (TIR-NBS class), putative [Arabidopsis thaliana].

MSSSSSSSSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSIPGGQYSEIWDGDAELIHQITVDIWNIFVASKSSDLCGLVGMDRHMKAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRFRQLSVRAIKLVGFLPLALKVTGSMLYRKKESYWETILQCFEEKQNKGTI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MSSSSSSSSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSIPG

Gene3D: G3DSA:3.40.50.10140
8-145 G3DSA:3.40.50.10140

SSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQL

ProfileScan: PS50104
IPR000157
10-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSI

HMMSmart: SM00255
IPR000157
11-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSI

HMMPfam: PF01582
IPR000157
14-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALS

superfamily: SSF52540
169-406 SSF52540

VDIWNIFVASKSSDLCGLVGMDRHMKAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGV

HMMPfam: PF00931
IPR002182
194-396 NB-ARC,NBS
NB-ARC

KAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILF

HMMPanther: PTHR11017
292-657 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRFRQLSVRAIKLVGFLPLALKVTGSMLYRKKESYWETIL

HMMPanther: PTHR11017:SF20
292-657 PTHR11017:SF20,SUBFAMILY NOT NAMED

FDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRFRQLSVRAIKLVGFLPLALKVTGSMLYRKKESYWETIL

superfamily: SSF52540
424-668 SSF52540

METFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRFRQLSVRAIKLVGFLPLALKVTGSMLYRKKESYWETILQCFEEKQNKGT

Gene3D: G3DSA:3.40.50.300
436-578 G3DSA:3.40.50.300

TRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTAR

HMMPfam: PF00931
IPR002182
454-665 NB-ARC,NBS
NB-ARC

ALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRFRQLSVRAIKLVGFLPLALKVTGSMLYRKKESYWETILQCFEEKQN

FPrintScan: PR00364
IPR000767
466-481 DISEASERSIST
Disease resistance protein

VVGIWGTGGIGKTTLS

FPrintScan: PR00364
IPR000767
538-552 DISEASERSIST
Disease resistance protein

LIQHRKVLLIVDDVD

FPrintScan: PR00364
IPR000767
631-645 DISEASERSIST
Disease resistance protein

VGFLPLALKVTGSML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox