PRGDB00047120 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18422652 (NM_123995)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G46260) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCATCTTCTTCTCGAAATTGGTTATATGATGTTTTCTTGAGCTTCAGAGGGGGAGACGTCCGTGTAACATTCCGTAGCCACTTTCTCAAGGAGTTCGATCGGAAACTGATCACTGCTTTCAGAGACAATGAGATCGAGAGAAGCCACTCTCTCTGGCCCGATCTTGAACAAGCCATCAAGGAATCGAGGATCGCAGTGGTCGTTTTCTCCAAAAACTACGCTTCATCGAGCTGGTGTCTTAACGAGTTGCTGGAGATTGTGAACTGCAATGATAAAATTATCATACCGGTTTTCTACGGTGTGGATCCTTCCCAAGTGAGGTATCAAATCGGTGAATTCGGGAAGATCTTTGAAAAGACATGCAAGAGACAAACAGAGGAAGTGAAAAACCAATGGAAGAAAGCGTTGACTCATGTAGCTAATATGCTTGGATTTGATTCTTCCAAATGGGATGACGAAGCAAAAATGATTGAAGAAATAGCCAATGATGTTTTGCGTAAACTGCTTTTAACTACATCGAAGGATTTTGAGGACTTTGTCGGCCTCGAGGATCATATTGCAAATATGAGTGCACTGTTGGATCTGGAATCTAAGGAAGTGAAGATGGTTGGTATATGGGGTTCCTCGGGGATTGGTAAGACTACCATTGCACGAGCTTTGTTTAACAACCTTTTTCGGCATTTCCAAGTTAGGAAATTCATAGACAGATCTTTTGCCTATAAGAGTAGAGAAATTCATAGTAGTGCCAATCCTGACGACCACAATATGAAGTTACATTTACAAGAGAGCTTCCTCTCTGAAATTCTAAGGATGCCGAACATAAAGATAGATCATCTAGGTGTACTAGGAGAGAGGCTACAACACCAGAAAGTTCTTATCATTATTGATGATGTGGATGATCAAGTGATCTTAGATTCATTGGTGGGTAAAACTCAATGGTTTGGAAATGGGAGCAGAATCATTGTGGTTACAAATAATAAACATTTTTTAACGGCTCATGGAATTGATCGTATGTATGAAGTTAGTCTCCCAACGGAAGAGCACGCTCTTGCAATGTTATGTCAATCTGCTTTCAAGAAAAAATCTCCACCTGAAGGTTTTGAGATGCTTGTAGTTCAAGTTGCAAGATATGCTGGTAGTCTTCCTCTGGTTCTTAAGGTTTTGGGTTCATATTTGAGTGGGAAGGATAAGGAGTACTGGATAGATATGCTGCCAAGGCTTCAAAATGGTTTAAACGATAAAATTGAGAGAATACTAAGAATCAGCTATGATGGGTTAGAGAGTGAAGATCAAGCGATATTTCGTCATATCGCATGTATTTTCAATCATATGGAAGTCACAACCATCAAGTCATTGCTCGCAAATAGTATATATGGTGCTAATGTTGGGCTGCAAAACCTGGTTGATAAGTCCATCATTCATGTCAGATGGGGTCATGTGGAGATGCATCCTTTGCTACAAGAAATGGGCAGAAAAATTGTTCGCACACAGTCCATTGGCAAGCCCCGAAAACGAGAATTTCTGGTGGATCCAAATGATATTTGTGATGTACTCAGTGAAGGCATTGATACTCAAAAGGTTTTAGGTATATCATTGGAGACAAGTAAGATTGATGAGTTGTGTGTACATGAGAGTGCCTTCAAACGGATGCGTAATCTCCGTTTCTTAAAAATTGGTACGGATATCTTTGGAGAAGAAAACAGATTGCATTTACCTGAAAGTTTCGACTATTTGCCTCCTACACTTAAACTATTGTGCTGGTCCGAATTTCCAATGAGGTGTATGCCTTCTAATTTTTGCCCTAAAAACCTTGTCACGCTCAAAATGACGAATAGTAAGCTACATAAGTTGTGGGAAGGAGCTGTGCCACTTACATGTCTAAAGGAAATGGATCTAGATGGATCAGTCAATCTGAAAGAAATTCCAGATCTTTCCATGGCTACTAATCTCGAGACACTTAATTTTGAGAATTGCAAGAGTTTGGTGGAGCTTCCTTCCTTTATACAAAATCTCAATAAGCTGTTGAAATTGAACATGGCATTCTGCAACAGTCTGGAAACTCTTCCAACTGGTTTTAACCTCAAATCTTTGAACCGCATCGATTTCACTAAATGCTCGAAGTTAAGGACTTTTCCGGACTTCTCAACCAACATCTCAGATCTCTATTTGACTGGAACAAACATTGAAGAACTCCCTTCTAATTTACATCTCGAGAATCTTATTGATCTTAGAATATCAAAAAAGGAGATTGATGGGAAACAATGGGAAGGAGTGATGAAGCCGCTTAAACCCTTACTGGCGATGTTGTCTCCCACTTTGACGAGCTTGCAACTCCAGAACATCCCAAATTTGGTGGAGCTTCCTTGCTCATTTCAGAATCTCATTCAACTGGAGGTTTTGGACATCACAAACTGTAGAAATCTGGAGACTCTGCCCACCGGAATCAACCTCCAATCTCTCGATAGCCTTAGTTTCAAGGGATGCTCACGGTTGAGGAGCTTTCCTGAAATCTCAACCAACATCTCAAGTCTCAATCTAGAGGAAACAGGGATTGAAGAAGTTCCTTGGTGGATCGATAAATTCTCTAACCTCGGTTTGCTAAGTATGGATCGTTGCAGCAGGCTAAAATGTGTATCCCTACACATTTCTAAACTGAAACGTCTTGGAAAAGTTGACTTTAAAGATTGTGGGGCGTTGACTATAGTTGATTTGTGTGGCTGTCCAATTGGGATGGAGATGGAAGCAAACAATATCGACACAGTTTCCAAAGTCAAACTTGATTTCAGGGACTGCTTCAACTTGGATCCAGAAACTGTACTTCACCAAGAATCAATTATTTTCAAGTACATGTTGTTTCCAGGGAAAGAAGAAATGCCATCATATTTCACTTACCGTACTACTGGAAGCTCCTCTCTGACCATTCCTCTACTTCACCTCCCTCTCTCCCAACCATTCTTCAGATTTAGGGTTGGCGCATTGGTAACTAATGTTAAGCATGGAAAAAATATAAAGGTGAAGTGTGAGTTCAAAGACAGATTTGGGAACAGCTTTCATGTTGGCTCGGATGATTTCTACGTTTATCTACTTTTCACGAAAAGTCAGAAGGGTAGTCAAATGTTAACTATATTGGACTGTTGTATCCCTCTAAACGAAGGTAATGCTTCTCTAGCTCAAGGGAACTACTACGATCATGTGGATATAAATATTCATATAAGTAGTGGAGGTTGGAGATCTACGTTTGAATTAAAAGAATGGGGTATACGACTCTTAGAGGAGGACTCTTCATCAGCAGAGAACGGACTTGGTAATCCAAACAGTACTCTTCCACATGTTTCTGAAGCCGAAGAAGGCAATATGGGGTATTATACACCTCTTCAAGAAGGACTTGTTAATGAGATTGAACACAGTGAAGAGTCTGGAGATATCAATGTAGGGACTAAGAGAAGCAAGAAGCGAATGCGGCCGAAGAAGACAATATGGGGTATTCACCGCTTCAAGAACTTACTGAGAAGCAGGAAGCGAATGCGTGTAAGCATTAAAAATGAAAGACCACTCAAGAAATCTAGGACTCGCCCTGCCTCAATACCTAGGACTGGGAGGAACACATGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSSSRNWLYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGEFGKIFEKTCKRQTEEVKNQWKKALTHVANMLGFDSSKWDDEAKMIEEIANDVLRKLLLTTSKDFEDFVGLEDHIANMSALLDLESKEVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDHLGVLGERLQHQKVLIIIDDVDDQVILDSLVGKTQWFGNGSRIIVVTNNKHFLTAHGIDRMYEVSLPTEEHALAMLCQSAFKKKSPPEGFEMLVVQVARYAGSLPLVLKVLGSYLSGKDKEYWIDMLPRLQNGLNDKIERILRISYDGLESEDQAIFRHIACIFNHMEVTTIKSLLANSIYGANVGLQNLVDKSIIHVRWGHVEMHPLLQEMGRKIVRTQSIGKPRKREFLVDPNDICDVLSEGIDTQKVLGISLETSKIDELCVHESAFKRMRNLRFLKIGTDIFGEENRLHLPESFDYLPPTLKLLCWSEFPMRCMPSNFCPKNLVTLKMTNSKLHKLWEGAVPLTCLKEMDLDGSVNLKEIPDLSMATNLETLNFENCKSLVELPSFIQNLNKLLKLNMAFCNSLETLPTGFNLKSLNRIDFTKCSKLRTFPDFSTNISDLYLTGTNIEELPSNLHLENLIDLRISKKEIDGKQWEGVMKPLKPLLAMLSPTLTSLQLQNIPNLVELPCSFQNLIQLEVLDITNCRNLETLPTGINLQSLDSLSFKGCSRLRSFPEISTNISSLNLEETGIEEVPWWIDKFSNLGLLSMDRCSRLKCVSLHISKLKRLGKVDFKDCGALTIVDLCGCPIGMEMEANNIDTVSKVKLDFRDCFNLDPETVLHQESIIFKYMLFPGKEEMPSYFTYRTTGSSSLTIPLLHLPLSQPFFRFRVGALVTNVKHGKNIKVKCEFKDRFGNSFHVGSDDFYVYLLFTKSQKGSQMLTILDCCIPLNEGNASLAQGNYYDHVDINIHISSGGWRSTFELKEWGIRLLEEDSSSAENGLGNPNSTLPHVSEAEEGNMGYYTPLQEGLVNEIEHSEESGDINVGTKRSKKRMRPKKTIWGIHRFKNLLRSRKRMRVSIKNERPLKKSRTRPASIPRTGRNT

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSSRNWLYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGEFGKIFEKTCKRQTEEVKNQWKKALTHVANMLGF

Gene3D: G3DSA:3.40.50.10140
7-146 G3DSA:3.40.50.10140

SRNWLYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGEFGKIFEKTCKRQTEEVKNQWKKALTHVANML

ProfileScan: PS50104
IPR000157
10-145 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WLYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGEFGKIFEKTCKRQTEEVKNQWKKALTHVANM

HMMSmart: SM00255
IPR000157
11-145 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGEFGKIFEKTCKRQTEEVKNQWKKALTHVANM

HMMPfam: PF01582
IPR000157
14-141 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGEFGKIFEKTCKRQTEEVKNQWKKALTH

HMMPanther: PTHR11017
31-1157 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGEFGKIFEKTCKRQTEEVKNQWKKALTHVANMLGFDSSKWDDEAKMIEEIANDVLRKLLLTTSKDFEDFVGLEDHIANMSALLDLESKEVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDHLGVLGERLQHQKVLIIIDDVDDQVILDSLVGKTQWFGNGSRIIVVTNNKHFLTAHGIDRMYEVSLPTEEHALAMLCQSAFKKKSPPEGFEMLVVQVARYAGSLPLVLKVLGSYLSGKDKEYWIDMLPRLQNGLNDKIERILRISYDGLESEDQAIFRHIACIFNHMEVTTIKSLLANSIYGANVGLQNLVDKSIIHVRWGHVEMHPLLQEMGRKIVRTQSIGKPRKREFLVDPNDICDVLSEGIDTQKVLGISLETSKIDELCVHESAFKRMRNLRFLKIGTDIFGEENRLHLPESFDYLPPTLKLLCWSEFPMRCMPSNFCPKNLVTLKMTNSKLHKLWEGAVPLTCLKEMDLDGSVNLKEIPDLSMATNLETLNFENCKSLVELPSFIQNLNKLLKLNMAFCNSLETLPTGFNLKSLNRIDFTKCSKLRTFPDFSTNISDLYLTGTNIEELPSNLHLENLIDLRISKKEIDGKQWEGVMKPLKPLLAMLSPTLTSLQLQNIPNLVELPCSFQNLIQLEVLDITNCRNLETLPTGINLQSLDSLSFKGCSRLRSFPEISTNISSLNLEETGIEEVPWWIDKFSNLGLLSMDRCSRLKCVSLHISKLKRLGKVDFKDCGALTIVDLCGCPIGMEMEANNIDTVSKVKLDFRDCFNLDPETVLHQESIIFKYMLFPGKEEMPSYFTYRTTGSSSLTIPLLHLPLSQPFFRFRVGALVTNVKHGKNIKVKCEFKDRFGNSFHVGSDDFYVYLLFTKSQKGSQMLTILDCCIPLNEGNASLAQGNYYDHVDINIHISSGGWRSTFELKEWGIRLLEEDSSSAENGLGNPNSTLPHVSEAEEGNMGYYTPLQEGLVNEIEHSEESGDINVGTKRSKKRMR

HMMPanther: PTHR11017:SF20
31-1157 PTHR11017:SF20,SUBFAMILY NOT NAMED

FLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKESRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGEFGKIFEKTCKRQTEEVKNQWKKALTHVANMLGFDSSKWDDEAKMIEEIANDVLRKLLLTTSKDFEDFVGLEDHIANMSALLDLESKEVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDHLGVLGERLQHQKVLIIIDDVDDQVILDSLVGKTQWFGNGSRIIVVTNNKHFLTAHGIDRMYEVSLPTEEHALAMLCQSAFKKKSPPEGFEMLVVQVARYAGSLPLVLKVLGSYLSGKDKEYWIDMLPRLQNGLNDKIERILRISYDGLESEDQAIFRHIACIFNHMEVTTIKSLLANSIYGANVGLQNLVDKSIIHVRWGHVEMHPLLQEMGRKIVRTQSIGKPRKREFLVDPNDICDVLSEGIDTQKVLGISLETSKIDELCVHESAFKRMRNLRFLKIGTDIFGEENRLHLPESFDYLPPTLKLLCWSEFPMRCMPSNFCPKNLVTLKMTNSKLHKLWEGAVPLTCLKEMDLDGSVNLKEIPDLSMATNLETLNFENCKSLVELPSFIQNLNKLLKLNMAFCNSLETLPTGFNLKSLNRIDFTKCSKLRTFPDFSTNISDLYLTGTNIEELPSNLHLENLIDLRISKKEIDGKQWEGVMKPLKPLLAMLSPTLTSLQLQNIPNLVELPCSFQNLIQLEVLDITNCRNLETLPTGINLQSLDSLSFKGCSRLRSFPEISTNISSLNLEETGIEEVPWWIDKFSNLGLLSMDRCSRLKCVSLHISKLKRLGKVDFKDCGALTIVDLCGCPIGMEMEANNIDTVSKVKLDFRDCFNLDPETVLHQESIIFKYMLFPGKEEMPSYFTYRTTGSSSLTIPLLHLPLSQPFFRFRVGALVTNVKHGKNIKVKCEFKDRFGNSFHVGSDDFYVYLLFTKSQKGSQMLTILDCCIPLNEGNASLAQGNYYDHVDINIHISSGGWRSTFELKEWGIRLLEEDSSSAENGLGNPNSTLPHVSEAEEGNMGYYTPLQEGLVNEIEHSEESGDINVGTKRSKKRMR

superfamily: SSF52540
65-438 SSF52540

SRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGEFGKIFEKTCKRQTEEVKNQWKKALTHVANMLGFDSSKWDDEAKMIEEIANDVLRKLLLTTSKDFEDFVGLEDHIANMSALLDLESKEVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDHLGVLGERLQHQKVLIIIDDVDDQVILDSLVGKTQWFGNGSRIIVVTNNKHFLTAHGIDRMYEVSLPTEEHALAMLCQSAFKKKSPPEGFEMLVVQVARYAGSLPLVLKVLGSYLSGKDKEYWIDMLPRLQNGLNDKIERILRISYDGLESEDQAIFR

Gene3D: G3DSA:3.40.50.300
158-215 G3DSA:3.40.50.300

KMIEEIANDVLRKLLLTTSKDFEDFVGLEDHIANMSALLDLESKEVKMVGIWGSSGIG

HMMPfam: PF00931
IPR002182
186-451 NB-ARC,NBS
NB-ARC

EDHIANMSALLDLESKEVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDHLGVLGERLQHQKVLIIIDDVDDQVILDSLVGKTQWFGNGSRIIVVTNNKHFLTAHGIDRMYEVSLPTEEHALAMLCQSAFKKKSPPEGFEMLVVQVARYAGSLPLVLKVLGSYLSGKDKEYWIDMLPRLQNGLNDKIERILRISYDGLESEDQAIFRHIACIFNHMEVTT

HMMSmart: SM00382
IPR003593
202-348 AAA,NBS
AAA+ ATPase domain

EVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDHLGVLGERLQHQKVLIIIDDVDDQVILDSLVGKTQWFGNGSRIIVVTNNKHFLTAHGIDRMYEVSLPT

FPrintScan: PR00364
IPR000767
205-220 DISEASERSIST
Disease resistance protein

MVGIWGSSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
216-256 G3DSA:3.40.50.300

KTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDD

Gene3D: G3DSA:3.40.50.300
260-356 G3DSA:3.40.50.300

KLHLQESFLSEILRMPNIKIDHLGVLGERLQHQKVLIIIDDVDDQVILDSLVGKTQWFGNGSRIIVVTNNKHFLTAHGIDRMYEVSLPTEEHALAML

FPrintScan: PR00364
IPR000767
288-302 DISEASERSIST
Disease resistance protein

RLQHQKVLIIIDDVD

FPrintScan: PR00364
IPR000767
381-395 DISEASERSIST
Disease resistance protein

AGSLPLVLKVLGSYL

superfamily: SSF52058
484-946 SSF52058,LRR

EMHPLLQEMGRKIVRTQSIGKPRKREFLVDPNDICDVLSEGIDTQKVLGISLETSKIDELCVHESAFKRMRNLRFLKIGTDIFGEENRLHLPESFDYLPPTLKLLCWSEFPMRCMPSNFCPKNLVTLKMTNSKLHKLWEGAVPLTCLKEMDLDGSVNLKEIPDLSMATNLETLNFENCKSLVELPSFIQNLNKLLKLNMAFCNSLETLPTGFNLKSLNRIDFTKCSKLRTFPDFSTNISDLYLTGTNIEELPSNLHLENLIDLRISKKEIDGKQWEGVMKPLKPLLAMLSPTLTSLQLQNIPNLVELPCSFQNLIQLEVLDITNCRNLETLPTGINLQSLDSLSFKGCSRLRSFPEISTNISSLNLEETGIEEVPWWIDKFSNLGLLSMDRCSRLKCVSLHISKLKRLGKVDFKDCGALTIVDLCGCPIGMEMEANNIDTVSKVKLDFRDCFNLDPETVLHQE

Gene3D: G3DSA:3.80.10.10
541-912 G3DSA:3.80.10.10

DELCVHESAFKRMRNLRFLKIGTDIFGEENRLHLPESFDYLPPTLKLLCWSEFPMRCMPSNFCPKNLVTLKMTNSKLHKLWEGAVPLTCLKEMDLDGSVNLKEIPDLSMATNLETLNFENCKSLVELPSFIQNLNKLLKLNMAFCNSLETLPTGFNLKSLNRIDFTKCSKLRTFPDFSTNISDLYLTGTNIEELPSNLHLENLIDLRISKKEIDGKQWEGVMKPLKPLLAMLSPTLTSLQLQNIPNLVELPCSFQNLIQLEVLDITNCRNLETLPTGINLQSLDSLSFKGCSRLRSFPEISTNISSLNLEETGIEEVPWWIDKFSNLGLLSMDRCSRLKCVSLHISKLKRLGKVDFKDCGALTIVDLCGCPI

HMMPfam: PF07725
IPR011713
606-623 LRR_3
Leucine-rich repeat 3

NLVTLKMTNSKLHKLWEG

HMMPfam: PF13306
647-733 LRR_5,Leucine rich repeats (6 copies)

LSMATNLETLNFENCKSLVELPSFIQNLNKLLKLNMAFCNSLETLPTGFNLKSLNRIDFTKCSKLRTFPDFSTNISDLYLTGTNIEE

FPrintScan: PR00364
IPR000767
795-811 DISEASERSIST
Disease resistance protein

QNLIQLEVLDITNCRNL

HMMPfam: PF13306
807-906 LRR_5,Leucine rich repeats (6 copies)

NCRNLETLPTGINLQSLDSLSFKGCSRLRSFPEISTNISSLNLEETGIEEVPWWIDKFSNLGLLSMDRCSRLKCVSLHISKLKRLGKVDFKDCGALTIVD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox