PRGDB00047130 (disease resistance protein (TIR-NBS class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18394507 (NM_101624)
Gene Class N
Domain Type TIR, TIR, NBS, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS class), putative (AT1G17615) mRNA, complete cds.

DNA Sequence

ATGTATTCATCATCGTCTTCTTCTTCAGCTACTCCACAAAAGTTCGACGTCTTTCTGAGTTTCAGAGGCAAGGACACTCGCAGGACCTTCATTAGCTTTCTTTACAAAGAACTCATTGAAATGGGTATTCGAACTTTCAAAGACGACGTTGAACTCCAGAGTGGTCGTCGGATTGCTTCAGATCTCCTCGCCGCGATCGAAAACTCCAAAATCGCCGTTGTGATTATCTCAAAGAATTACTCTGCGTCTCCCTGGTGTCTCCAAGAGCTAGTGATGATCATGGATGTCGAAAAGAAGGGTTCCATCATCGTTATGCCAATCTTTTACAACGTCGAGCCTGCTCATGTGAGAAGACAAATCGAACAGGTCGCTAAACAGTTTAGGAAACATGAAGGAAGGGAAAATTATGAGACTGTGGTGTCATGGAGACAAGCTCTGACCAATTTGGCCAGTATCTCCGGCCATTGTTCTCGTGATTGCGAAGATGACTCGAAGCTACTCGATGAGATAACCAAGAGAATTTCTGACATGTTATTCTCGGTAACACCACCAAGTGAGAGCATCAATAACCAACTTGGATTTGATGCACGCATGAAAGAGTTGTATCCATTGTTGGATTTGGATTCTAATGAAGGTGTGAGAGTGGTTGGAATTTGGGCAAGAGGAGGTAATGGAAGATCAGCTCTAGCTAGATACGTTTATCAAAAGATCTTTAAGAAATTCCAAAGTCATTGTTTTCTCGAAAACGTCAAAGGGATCCCTCACGATTGTCAAATGTCGAATCTAAGAGACGAGTTTCTTATCAGGATTCAAGGAGGGTACTCGAGGATGAAGACCTCAGGGTTGATAAAAAAAAGGCTCATGAGTCAGAAAGTTCTACTTGTGGCTAACAATGTCGACAAACTCGAACAGTTAGATGCTCTTGCAGAATATTTTAACTGTTTTGGTCCAGGGAGCATAGTGCTCATAACTACACAAGACAAACAACTTCTTGTTGCGTTTGGGATAAAGGTTGTGTATGAAGTTGAGTGCTTGAGATGCTTTGAAGTTCGTCAACTGTTTCGTCAAATCGGCTTTAGGGAAAGAGATCTTAATGTCGGTTCCGAGTTGTCTTCACCTATATCCGGGACTGAATCTTCTTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS class), putative disease resistance protein (TIR-NBS class), putative [Arabidopsis thaliana].

MYSSSSSSSATPQKFDVFLSFRGKDTRRTFISFLYKELIEMGIRTFKDDVELQSGRRIASDLLAAIENSKIAVVIISKNYSASPWCLQELVMIMDVEKKGSIIVMPIFYNVEPAHVRRQIEQVAKQFRKHEGRENYETVVSWRQALTNLASISGHCSRDCEDDSKLLDEITKRISDMLFSVTPPSESINNQLGFDARMKELYPLLDLDSNEGVRVVGIWARGGNGRSALARYVYQKIFKKFQSHCFLENVKGIPHDCQMSNLRDEFLIRIQGGYSRMKTSGLIKKRLMSQKVLLVANNVDKLEQLDALAEYFNCFGPGSIVLITTQDKQLLVAFGIKVVYEVECLRCFEVRQLFRQIGFRERDLNVGSELSSPISGTESS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR22662
IPR017279
1-380 PTHR22662,TIRAP
Toll-interleukin 1 receptor domain-containing adap

MYSSSSSSSATPQKFDVFLSFRGKDTRRTFISFLYKELIEMGIRTFKDDVELQSGRRIASDLLAAIENSKIAVVIISKNYSASPWCLQELVMIMDVEKKGSIIVMPIFYNVEPAHVRRQIEQVAKQFRKHEGRENYETVVSWRQALTNLASISGHCSRDCEDDSKLLDEITKRISDMLFSVTPPSESINNQLGFDARMKELYPLLDLDSNEGVRVVGIWARGGNGRSALARYVYQKIFKKFQSHCFLENVKGIPHDCQMSNLRDEFLIRIQGGYSRMKTSGLIKKRLMSQKVLLVANNVDKLEQLDALAEYFNCFGPGSIVLITTQDKQLLVAFGIKVVYEVECLRCFEVRQLFRQIGFRERDLNVGSELSSPISGTESS

superfamily: SSF52200
IPR000157
3-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSSSSSATPQKFDVFLSFRGKDTRRTFISFLYKELIEMGIRTFKDDVELQSGRRIASDLLAAIENSKIAVVIISKNYSASPWCLQELVMIMDVEKKGSIIVMPIFYNVEPAHVRRQIEQVAKQFRKHEGRENYETVVSWRQALTNLASISGH

Gene3D: G3DSA:3.40.50.10140
12-150 G3DSA:3.40.50.10140

PQKFDVFLSFRGKDTRRTFISFLYKELIEMGIRTFKDDVELQSGRRIASDLLAAIENSKIAVVIISKNYSASPWCLQELVMIMDVEKKGSIIVMPIFYNVEPAHVRRQIEQVAKQFRKHEGRENYETVVSWRQALTNLA

ProfileScan: PS50104
IPR000157
13-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QKFDVFLSFRGKDTRRTFISFLYKELIEMGIRTFKDDVELQSGRRIASDLLAAIENSKIAVVIISKNYSASPWCLQELVMIMDVEKKGSIIVMPIFYNVEPAHVRRQIEQVAKQFRKHEGRENYETVVSWRQALTNLASI

HMMSmart: SM00255
IPR000157
14-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KFDVFLSFRGKDTRRTFISFLYKELIEMGIRTFKDDVELQSGRRIASDLLAAIENSKIAVVIISKNYSASPWCLQELVMIMDVEKKGSIIVMPIFYNVEPAHVRRQIEQVAKQFRKHEGRENYETVVSWRQALTNLASI

HMMPfam: PF01582
IPR000157
17-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGKDTRRTFISFLYKELIEMGIRTFKDDVELQSGRRIASDLLAAIENSKIAVVIISKNYSASPWCLQELVMIMDVEKKGSIIVMPIFYNVEPAHVRRQIEQVAKQFRKHEGRENYETVVSWRQALT

superfamily: SSF52540
171-360 SSF52540

TKRISDMLFSVTPPSESINNQLGFDARMKELYPLLDLDSNEGVRVVGIWARGGNGRSALARYVYQKIFKKFQSHCFLENVKGIPHDCQMSNLRDEFLIRIQGGYSRMKTSGLIKKRLMSQKVLLVANNVDKLEQLDALAEYFNCFGPGSIVLITTQDKQLLVAFGIKVVYEVECLRCFEVRQLFRQIGFR

HMMPfam: PF00931
IPR002182
204-362 NB-ARC,NBS
NB-ARC

LLDLDSNEGVRVVGIWARGGNGRSALARYVYQKIFKKFQSHCFLENVKGIPHDCQMSNLRDEFLIRIQGGYSRMKTSGLIKKRLMSQKVLLVANNVDKLEQLDALAEYFNCFGPGSIVLITTQDKQLLVAFGIKVVYEVECLRCFEVRQLFRQIGFRER






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox