PRGDB00047140 (TIR-NBS-LRR class disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR class disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 121544145 (EF157840)
Gene Class TNL
Domain Type LRR, NBS, TIR, Others
Gene Species (Populus tomentosa x P. bolleana) x P. tomentosa

Comment?

(Populus tomentosa x P. bolleana) x P. tomentosa TIR-NBS-LRR class disease resistance protein mRNA, complete cds.

DNA Sequence

ATGCAGAAAGAAAAACGCAAGCAATCCAAAGATGAAGACAACGATTCATCCTTGCGGAAGAGAAGAAAAGCTGACCTCAGTAAGCCTGTCAGTTTTGTCTCCACAGCTGCCAAGACAGAGCCAGAGTCTTCTCGATCTAGACCAGAAGGGGCCTATGATGTCTTCTTGAGTTTTAGAGGAGAAGACACTCGCAAGACATTTACAGATCATCTATATACTGCCTTGGTCCAAGCAGGAATCCACACTTTTCGAGATGATGATGAACTTCCGAGAGGAGAAGAAATCTCCCATCATCTCCTTAGGGCAATTGAAGAATCAAGGATATCCATAGTTGTCTTCTCAAAAGGATATGCTTCTTCTAGATGGTGTCTCAATGAACTTGTAGAGATTCTTAAGTGCAAAAATAGGAAAACCGGTCAGATTGTTCTTCCTATATTCTTTGACATTGATCCTTCAGATGTGAGAAAACAGACTGCCAGTTTTGCGGAAGCATTTGTTAAACATGAAGAGCGTTCTCAAGAGAAGTTGGTGCAGGAGTGGAGAAAAGCTCTTAAGGAGGCTGGAAATCTATCTGGATGGAATCTGAATGATATGGCAAATGGGCATGAAGCAAAATTTATCAAAGAGATTATCAATGATGTGTTCAATAAATTAAGTCGCGAGTACTTATCTGTTCCTGAGCACCTAGTAGGTATGGATCTTGCTCATGATATTTTGGACTTTCTAAGTACTGCAACAGATGATGTATGCATTGCGGGCATACATGGGATGCCAGGAATAGGAAAGACGACAATAGCAAAAGTTGTATTTAATCAACTCTACTACAGATTCGAGGGAAGCTGCTTTCTTTCGAATATCAATGAAACATCAAAACAATTCAATGGTCTGGCTCTTTTACAAAAGCAACTTCTTCATGATATTTTAAAACAAGATGTTGCTAACATCAATTGTGTTGATAGAGGAAAGGTTCTGATCAAAGAGCGAATTCGTCGCAAAAGAGTTCTTGTTGTTGCTGATGATGTGGCTCATCCGGAACAGCTGAATGCATTGATGGGAGAGCGAAGTTGGTTAGGTCGCGGAAGTAGAGTAATTATTACAACAAGAGATTCTAGTGTTCTACTTAAGGCAGATCAAACATATCAGATCGAAGAATTGAAACCATATGAGTCCCTTCAGCTTTTCCGATGGCATGCCTTGAGGGACACAAAGCCAACAGAAGATTATATGGAGCTTTCGAAGGATGCAGTTGATTACTGTGGAGGACTTCCTTTAGCCCTTGAGGTTATGGGTGCTTGTCTGTCCGGGAAAAACAGAGATGGTTGGAAATGTGTAATTGAAAAATTGAGAAGAATTCCACACCACGATATTCAAGGAAAGCTTAGAACAAGTTTTGACGCACTGGACGGTGAAGAACTACGAAATGCATTCCTTGATATCGCTTGCTTCTTTATTGATAGAAAGAAAGAGTACGTCGCAAAAGTGCTAGGAGCCCGTTGCGGTTACAATCCAGAAGTTGATTTGGAAACTCTCCGTGAAAGGTCTCTGATTAAAGTTAATTGCTTTGGAAAGATAACCATGCATGATCTATTTCGAGACATGGGAAGGGAGGTCGTTCGTGAATCGTCTCCAAAAGAACCTGGAAAGAGGACCAGAATTTGGAATCAAGAGGATGCATGGAATGTACTTCAGCAGCAGAAGGGTACGGATGTTGTAGAGGGTCTTACACTGGATGTCAGAGCATCAGAAGCTAAATCACTGAGCGCAAGATCATTTGCAAAAATGAAATGCTTAAATTTACTCCAAATCAATGGAGTACATCTCACCGGATCCTTCAAACTGCTTTCTAAAGAGTTGATGTGGATTTGTTGGCTTCAATGTCCTTTGAAATATTTGCCATCTGATTTTATCTTGGATAATCTAGTTGTTCTTGATACACAGTACAGTAACCTTAAAGAACTATGGAAGGGAGAAAAGGTGCGAAACATCTTACAATCCCCAAAATTTCTCCATTATGTAATTTATATTTACATGTTATGA


Protein sequences

Name Description Sequence
TIR-NBS-LRR class disease resistance protein TIR-NBS-LRR class disease resistance protein [(Populus tomentosa x P. bolleana) x P. tomentosa].

MQKEKRKQSKDEDNDSSLRKRRKADLSKPVSFVSTAAKTEPESSRSRPEGAYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALKEAGNLSGWNLNDMANGHEAKFIKEIINDVFNKLSREYLSVPEHLVGMDLAHDILDFLSTATDDVCIAGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALLQKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWLGRGSRVIITTRDSSVLLKADQTYQIEELKPYESLQLFRWHALRDTKPTEDYMELSKDAVDYCGGLPLALEVMGACLSGKNRDGWKCVIEKLRRIPHHDIQGKLRTSFDALDGEELRNAFLDIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRERSLIKVNCFGKITMHDLFRDMGREVVRESSPKEPGKRTRIWNQEDAWNVLQQQKGTDVVEGLTLDVRASEAKSLSARSFAKMKCLNLLQINGVHLTGSFKLLSKELMWICWLQCPLKYLPSDFILDNLVVLDTQYSNLKELWKGEKVRNILQSPKFLHYVIYIYML

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
40-193 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EPESSRSRPEGAYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALKEAGNLSGW

ProfileScan: PS50104
IPR000157
50-190 TIR
Toll/interleukin-1 receptor homology (TIR) domain

GAYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALKEAGNL

Gene3D: G3DSA:3.40.50.10140
51-185 G3DSA:3.40.50.10140

AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALK

HMMSmart: SM00255
IPR000157
51-190 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALKEAGNL

HMMPfam: PF01582
IPR000157
54-185 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALK

HMMPanther: PTHR11017:SF20
77-656 PTHR11017:SF20,SUBFAMILY NOT NAMED

QAGIHTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALKEAGNLSGWNLNDMANGHEAKFIKEIINDVFNKLSREYLSVPEHLVGMDLAHDILDFLSTATDDVCIAGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALLQKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWLGRGSRVIITTRDSSVLLKADQTYQIEELKPYESLQLFRWHALRDTKPTEDYMELSKDAVDYCGGLPLALEVMGACLSGKNRDGWKCVIEKLRRIPHHDIQGKLRTSFDALDGEELRNAFLDIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRERSLIKVNCFGKITMHDLFRDMGREVVRESSPKEPGKRTRIWNQEDAWNVLQQQKGTDVVEGLTLDVRASEAKSLSARSFAKMKCLNLLQINGVHLTGSFKLLSKELMWICWLQCPLKYLPSDFILDNLVVLDTQYSNLKELWKG

HMMPanther: PTHR11017
77-656 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QAGIHTFRDDDELPRGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAFVKHEERSQEKLVQEWRKALKEAGNLSGWNLNDMANGHEAKFIKEIINDVFNKLSREYLSVPEHLVGMDLAHDILDFLSTATDDVCIAGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALLQKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWLGRGSRVIITTRDSSVLLKADQTYQIEELKPYESLQLFRWHALRDTKPTEDYMELSKDAVDYCGGLPLALEVMGACLSGKNRDGWKCVIEKLRRIPHHDIQGKLRTSFDALDGEELRNAFLDIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRERSLIKVNCFGKITMHDLFRDMGREVVRESSPKEPGKRTRIWNQEDAWNVLQQQKGTDVVEGLTLDVRASEAKSLSARSFAKMKCLNLLQINGVHLTGSFKLLSKELMWICWLQCPLKYLPSDFILDNLVVLDTQYSNLKELWKG

superfamily: SSF52540
212-456 SSF52540

NDVFNKLSREYLSVPEHLVGMDLAHDILDFLSTATDDVCIAGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALLQKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWLGRGSRVIITTRDSSVLLKADQTYQIEELKPYESLQLFRWHALRDTKPTEDYMELSKDAVDYCGGLPLALEVMGACLSGKNRDGWKCVIEKLRRIPHHDI

HMMPfam: PF00931
IPR002182
236-487 NB-ARC,NBS
NB-ARC

HDILDFLSTATDDVCIAGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALLQKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWLGRGSRVIITTRDSSVLLKADQTYQIEELKPYESLQLFRWHALRDTKPTEDYMELSKDAVDYCGGLPLALEVMGACLSGKNRDGWKCVIEKLRRIPHHDIQGKLRTSFDALDGEELRNAFLDIACFFIDRK

FPrintScan: PR00364
IPR000767
251-266 DISEASERSIST
Disease resistance protein

IAGIHGMPGIGKTTIA

Gene3D: G3DSA:3.40.50.300
252-372 G3DSA:3.40.50.300

AGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALLQKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWLGRGSRVIITTRDSSV

FPrintScan: PR00364
IPR000767
328-342 DISEASERSIST
Disease resistance protein

RIRRKRVLVVADDVA

FPrintScan: PR00364
IPR000767
419-433 DISEASERSIST
Disease resistance protein

CGGLPLALEVMGACL

superfamily: SSF46785
454-563 SSF46785

HDIQGKLRTSFDALDGEELRNAFLDIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRERSLIKVNCFGKITMHDLFRDMGREVVRESSPKEPGKRTRIWNQEDAWNVLQ

superfamily: SSF52058
537-656 SSF52058,LRR

VVRESSPKEPGKRTRIWNQEDAWNVLQQQKGTDVVEGLTLDVRASEAKSLSARSFAKMKCLNLLQINGVHLTGSFKLLSKELMWICWLQCPLKYLPSDFILDNLVVLDTQYSNLKELWKG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox