PRGDB00047143 (RGA)

From PRG Wiki
Jump to: navigation, search
RGA
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 81250732 (DQ239434)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Zizania latifolia

Comment?

Zizania latifolia clone Zi-YFL16 disease resistance gene analog (RGA) gene, partial cds.

DNA Sequence

GGAATGGGTGGAGTTGGCAAGACAACACTAGCTCAAAAAATATTCAATGATGCAAAAATAAAACAGTGCTTCAATGAAGTAGCATGGGTCTGTGTTACCAAAGACCACTCTGAGGAATCTCTTTTGAGACAAGTTCTTCAAAATATGAAAGTTCCACACGAGCAAGATGAATCTGTAGCTATTCTCCAAAGAAAGCTCAAATCGGCCATTGAGAATAAAAGTTTTTTCCTTGTGTTGGATGATGTGTGGAAGTCAGACACATGGACACATTTACTAAGAGTTCCACTACATACTGCAGCCACAGGAACAATTATAGTAACAACTCGACAAGATACTATTTCTCTAGAAATAGGGGCAGATCATACTCATCGAGTTGATTTGATGGATGTTGATGAAGGTTGGGAGCTACTTTGGAAGAGCATGGACATCGATTTAGAGAAAAAGGTGCAACACCTGCAGGACATTGGGATTGAGATTGTTCGCAGATGTGGTGGCCTCCCACTCGCTCT


Protein sequences

Name Description Sequence
disease resistance gene analog disease resistance gene analog [Zizania latifolia].

GMGGVGKTTLAQKIFNDAKIKQCFNEVAWVCVTKDHSEESLLRQVLQNMKVPHEQDESVAILQRKLKSAIENKSFFLVLDDVWKSDTWTHLLRVPLHTAATGTIIVTTRQDTISLEIGADHTHRVDLMDVDEGWELLWKSMDIDLEKKVQHLQDIGIEIVRRCGGLPLAL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-95 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGVGKTTLAQKIFNDAKIKQCFNEVAWVCVTKDHSEESLLRQVLQNMKVPHEQDESVAILQRKLKSAIENKSFFLVLDDVWKSDTWTHLLRVP

HMMPfam: PF00931
IPR002182
1-170 NB-ARC,NBS
NB-ARC

GMGGVGKTTLAQKIFNDAKIKQCFNEVAWVCVTKDHSEESLLRQVLQNMKVPHEQDESVAILQRKLKSAIENKSFFLVLDDVWKSDTWTHLLRVPLHTAATGTIIVTTRQDTISLEIGADHTHRVDLMDVDEGWELLWKSMDIDLEKKVQHLQDIGIEIVRRCGGLPLAL

HMMPanther: PTHR23155:SF121
1-95 PTHR23155:SF121,SUBFAMILY NOT NAMED

GMGGVGKTTLAQKIFNDAKIKQCFNEVAWVCVTKDHSEESLLRQVLQNMKVPHEQDESVAILQRKLKSAIENKSFFLVLDDVWKSDTWTHLLRVP

superfamily: SSF52540
1-170 SSF52540

GMGGVGKTTLAQKIFNDAKIKQCFNEVAWVCVTKDHSEESLLRQVLQNMKVPHEQDESVAILQRKLKSAIENKSFFLVLDDVWKSDTWTHLLRVPLHTAATGTIIVTTRQDTISLEIGADHTHRVDLMDVDEGWELLWKSMDIDLEKKVQHLQDIGIEIVRRCGGLPLAL

Gene3D: G3DSA:3.40.50.300
1-113 G3DSA:3.40.50.300

GMGGVGKTTLAQKIFNDAKIKQCFNEVAWVCVTKDHSEESLLRQVLQNMKVPHEQDESVAILQRKLKSAIENKSFFLVLDDVWKSDTWTHLLRVPLHTAATGTIIVTTRQDTI

FPrintScan: PR00364
IPR000767
69-83 DISEASERSIST
Disease resistance protein

AIENKSFFLVLDDVW

FPrintScan: PR00364
IPR000767
163-170 DISEASERSIST
Disease resistance protein

CGGLPLAL


List of References

Yu Chen, Likun Long, Xiuyun Lin, Wanli Guo, Bao Liu
Isolation and characterization of a set of disease resistance-gene analogs (RGAs) from wild rice, Zizania latifolia Griseb. I. Introgression, copy number lability, sequence change, and DNA methylation alteration in several rice-Zizania introgression lines.
Genome: 2006, 49(2);150-8
PubMed:16498465 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox