PRGDB00047148 (TIR-NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 105922449 (DQ513203)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone 37545 TIR-NBS-LRR type disease resistance protein mRNA, complete cds.

DNA Sequence

ATGGAGAGTGAGCAATCTTCAAAAGAAGGATTGGTGCTTGTTTCCAAGCCTCTCAACGGCGATAATTATTCAACTTGGTGCCGATCCATGACCATCTCTTTAAATGCCAAATCTAAATTGGGTTTTATAGATGGTACAATAGCAATGCCGTCTGCCAAGAGCCAACCAGATGCTCATGCTTCATGGAGAAAGTGCAACGATATGATTCTATCATGGATCCTTAATTCAATCACACCGGATCTTGCAGATACTCAGATGACTGTTGCAGCCTACTATACGAAGCTGAAAGGATTATGGGATGAACTGGGTTCCTATAACGGAACCATTTGCTCTTGTGGGGCAGATCATAAACGACGCCAGTTGATGCAATTTCTCATGGGTCTAAATGAATCCTACAAAGCAATCAGAGGGCAAATCTTATTGATGAATCCGTTACCTGATGTTCGCCAAGCTTACTCTTCCATCGTTCAAGAAGAAAAGCAGCGCAGCTTATGTGACATACATGAGACAACTGAAACTGCAGCCATGGCAGTTCAAAGAAATGAACCCACAGCCTTGGCTGTTCAACCAGGACACGGTTTTTCCCACTCCAATTCCTCTAACCGCAAGCCATTGCACTGCTCATATTGTGATAATGATCATCATGTACGAGACACATGTCATCCAAAACATAAATCAACTCGATTCAATCGCAAAGGCAGTCGTTCTCAGTTTGAAAATTCCGCTCAGTCTTCAGCCAATCATGTTAAGGAAGGACCAGCACTACAGGAAATGCAGTCCGTGATGAATGGACTTTCTGATATACAATTTCAGCAGATATTATCTATTATGAACAATAAGGGGACAAATCAATCCTCCAATCCTAAGGGCAATGCTGCTGGTACTTCTTCAGGTTTGTCACAAACATCATTGCGCCTCCATCGATTGGTCCTCGATAGTGGTGAAACTGATCATATTACCTCTTCTCCGAATTTGCTTATTAATAGTCGTCAGAACACTATTTTACCGCCAATTATTATGCCAAGTGGAGAACAGGCCCCAATCACATCTATTGGAACTTTACCCTTGAACTCTGTTATTTCTCTTAAAAATGTGCTTGGTGTGCCATCTTTTAAGGTGTATTTGATGTCTGACTTGACGACAAAGACGACGATTGGTTTGGGTAAACAACGAGCCACTTCCACCTTTGCTCCACCCGATCCTGCCAGCCTCGTTCAACCCCCTTCTTCCATCACTCCAGTGCAGCCCTTACGTCGTTCTCAACGACATCATAGTCCTCCTCGTGCTTTATGTGATTATGTATGCAACAACGTGACATCTCCCAAACCATCGACGTCTTCATCGTCTGGTTCCACCACAGCTTTAGCAGCCAACCACACTTGGTCTCTCACTCCTCTCCCTCCTGGAAAACAACCGATTGGATGTCGCTGGGTTTATAAAATCAAACGTCGCTCGGATGGCACCATAGAGCGTTATAAAGCTCGTTTGGTGGCCAAGGGTTATACACAGCTGGAAGCTCTAGCAGCTGCCCAGGATTGGTCCCTTCACCAGCTCGATGTAAACAACGCTTTCCTTCATGGTGATCTCCATGAAGAAATTTATGTGTCCGCCTCCTGGTCTTCAGCGACAAGGGGAGAACTTGTTATTCAAGATGCCGGATATGTTCAGTCCAAAGCAGACTACTCGTTGTTCACATGTCGAAATGGCAAGTCCTTTACCGCTTTGTTGATATACGTTGATGATATTCTTATTACAGGTAATGATCTCAAGGCTATATCAACTCTGAAGCAATTTTTGCATAGTCGTTTCCGAATTAAAGATTTGGGTGCTTTGAAATATTTTCTGGGCATTGAGGTCTCTCGGTCAAAGAAAGGTATTTCTATCTCACAGCGGAAATACACTTTGGAAATTCTAAAGGATGGTGGAATTTTAGGTGCTAAACCTGTGAACTTTCCCATGGAGCAAAACACAAAACTCTCAGATACTGGGCTGGTTGTCCAATGCACTACGGACTATTATGTTTTTTTGGGATCTTCACTTATTTCTTGGCGAACAAAAAGGCAGAAACCAGTGTCACTCTCCTCAACAGAAGCCGAATATAGAGCCATGGCCGATACATGCTATGAGTTATCTTGGTTATGTTCATTGTTGAAAGATTTACGAATATTGCATTCAAAACCAACATTGCTACTTTGTGATAACAAAGCAGTCTTACATATAACATCCAATCCTGTTTTCCATGAAAGAACCAGACACATAGAAATGGATTGCCACTTTATTCGAGACAAAATACAGGATGGTTCGATTGTGACCAAATTTGTTACTTCAGCAAATCAACTTGCGGATGTATTCACTAAACCATTGGAACTTTTGCATGCACATATTAATACACGGTTTATGGTGTTTTTTTCACGAAAGATCCGTAAGAAAATCATTGGAAACTTACCAGTACGAGTTCTTGACCTCAAGAAACCGGAAACAATTCGAAGTCATTGGAATAAAAAGAAAGAAAAGGGCTTTGGAAGTTGTTTTAGAGGCAAAGACACCCGGAACAACTTTACTAGCCATCTATATTCTAATCTGACACAGAGAGGCATCAAGGTATACAGGGATGACAGCGAGCTCGAGAGAGGAAAGACCATCGAACCTGCTCTCTGGAAGGCCATCGAAGAATCAAGGTTTTCTGCCATTATATTTTCAAGAGATTACGCTTCTTCACCATGGTGCCTGGATGAACTTGTCAAGATTGTTCAGTGCATGAAAGAGAAGGGGCAAACTGTTCTGCCAGTTTTTTATGATGTGGATCCCTCAGAGGTAGCTGAGCAGAAAGGGAAATATAAAAAAGCCTTCGTTAAGCATGAACAAAATTTCAAGGAAAACTTGGAGAAGGTCCGGAACTGGAAAGATTGTCTCTCTATGGTGGCCAATCTATCTGGCTGGGACGTACGGAATAGGGATGAATCGGAATCAATTAAAGCAATTGCTGACTGCATATCGTACAAACTAAGCCTCACTCTGCCAACAATTAGCAAAGAATTAGTTGGAATAGATTCTCGTCTAGAGGTATTAAATGGTTATATAGGTGAAGAAACTGGCGAAGCAATCTTCATAGGGATTTGTGGAATGGGTGGCATAGGTAAGACGACTGTTGCAAGGGTACTATATGATAGGATTCGTCGGCGATTTGAAGGCAGCTGCTTCTTAGCAAATGTCAGAGAAGCTTTTGCTGAGAAAGATGGACCACGCAGTTTACAGAAAAAACTTCTTTCTGATATCTTAATGGAACGTGATATTAATATATGTGATTCTTCTACAGGAATTGAAATGATAAAGCAGAAGTTACAACGTATAAAGATTCTTGTTGTTCTTGATGATGTAAATGACCGTAAACAACTAGAATACCTGGCTAAGGAGCCTGGATGGTTTGGTCCAGGGAGCAGAATTATCATAACAAGCAGAGATACAAATGTGTTAATTGGAAATGATGATACTAAAATTTACGAGGCTGAGAAATTGAATGATGATGATGCTCTTATGTTATTTAGCCAGAAAGCTTTCAAAAATGACCAGCCTGCTGAAGGTTTTGTGGAACTATCCAAGCAAGTTGTGGATTATGCTAATGGCCTTCCACTAGCTCTTGAAGTTATAGGTTCGTTTTTGTATGAAAGAAGTATCCCTGAATGGAGAGGTGCAATTAATAGAATGAATGAGATTCCTGACTGCAAAATTATTGATGTGCTTCGCGTTAGTTTTGATGGCCTCCATGAATCAGATAAGAAAATATTTTTAGACATTGCATGTTTCCTGAAGGGGTTTAAAAAAGATCGAATAACAAGGATACTTGAAAGCCGAGGATTCCATGCAGGTATTGGAATACCAGTTCTTATTGAGAGATCTCTTATAAGTGTCTCTCGGGATCAAGTCTGGATGCATGATTTGTTACAGATAATGGGTAAGGAAATTGTTCGTTGTGAATCCCCTGAAGAGCCTGGAAGGCGCAGTAGATTGTGGACATACGAGGATGTCTGCCTTGCACTGATGGACAACACAGGAAAAGAAAAAATAGAAGCCATATTTTTGGACATGCCTGGAATTAAAGAGGCACAGTGGAACATGAAAGCCTTCTCTAAAATGAGCAGACTAAGATTGCTCAAAATCAACAACTTGCAGCTTTCTAAAGGACCTGAAGATCTTTCCAATCAGTTACGATTTCTTGAATGGCATTCTTACCCTTCAAAATCATTGCCAGCTGGTTTACAGGTGGATGAGCTAGTTGAACTTCACATGGCTAACAGTAGTATTGAACAATTATGGTATGGGTATAAGAGTGCAGTTAATTTGAAAATCATCAATCTCAGCAACTCACTAAACCTGTCCAGGACTCCAGATCTTACTGGAATTCCAAATCTCGAGAGTCTGATTCTTGAAGGTTGTACAAGTTTGTCTAAGGTCCATCCATCACTTGGAAGTCACAAGAATCTTCAATATGTGAATCTTGTGAATTGCGAAAGTATTAGGATTCTCCCAAGCAACCTTGAAATGGAATCGCTTAAAGTTTTCACTCTTGATGGCTGCTCAAAACTTGAGAAGTTTCCAGATGTACTAGGAAACATGAACTGTTTGATGGTGCTTTGTTTGGACGAGACTGAGCTTAAAGAATGGCAGCATGGATCCTTTAGCAACATTGAGTTGTCATTTCATTCTTCCCAGCCAAGAGTAAAGGTGAAGAATTGTGGTGTCTGTTTGTTATCTTCTCTATATATTACATCACAACCATCTTCTGCCCATTTTATTGTTACAAGCAAAGAAACAGCTTCTTCATATAAAGCTTCTTTAACTCTCTCTTCATCGTACCATCATTGGATGGCCAGTGTTTTCCCTGACATCAGAGTCGCAGACACTAGTAATGCTATCACCTATTTAAAGTCAGATCTAGCTCGGAGAGTCATTATCTCATTGAACGTAAAGGCAATTAGATCAAGACTTTTTAAGGCCATTGAAGAATCAGGGCTGTCAATTGTTATATTTTCAAGAGATTGTGCTTCTTTACCTTGGTGCTTTGACGAACTTGTCAAGATTGTCGGATTCATGGATGAGATGAGATCGGACACTGTGTTTCCAGTTTCGTATGATGTCGAACAATCAAAGATAGATGATAAAAAAGAGAGTTACACAATTGTCTTTGATAAGATTGGAAAAAATCTCAGGGAAAACAAGGAGAAGGTACAAAGATGGATGGATATTCTCAGTGAAGTTGAGATTTCATCTGAATTGAGTTCATCGGAAAGTTTGACTATATCTGAGCTGCAGCAGCTGCTCGAGCAGCAGGAGCAGGTGCTCGAGCAGGAGGAGCAGAACCTGCAGCAGGAGGAGCAGCAGTTGCAGCAGTTGCTCGATCAGCAGGTGCTCCAGCAATGGCGACGGCAGGTGCTCCAGCCGGAGAGGCGACAGCTGCTCCAGCCGGAGAGGCGGCAGCTGCAGCAGGAGCAGCGGCTGCGGCGGCGGCTGCGGCAGCTCCGTCTGCGGCGGCAGCTCCGGCAGCTCCGGCTGCTCCAGCAGCGGCGGCAGCTCACCGGGTTTTGGTTAGTAATTAACTTGCTTTAG


Protein sequences

Name Description Sequence
TIR-NBS-LRR type disease resistance protein TIR-NBS-LRR type disease resistance protein [Populus trichocarpa].

MESEQSSKEGLVLVSKPLNGDNYSTWCRSMTISLNAKSKLGFIDGTIAMPSAKSQPDAHASWRKCNDMILSWILNSITPDLADTQMTVAAYYTKLKGLWDELGSYNGTICSCGADHKRRQLMQFLMGLNESYKAIRGQILLMNPLPDVRQAYSSIVQEEKQRSLCDIHETTETAAMAVQRNEPTALAVQPGHGFSHSNSSNRKPLHCSYCDNDHHVRDTCHPKHKSTRFNRKGSRSQFENSAQSSANHVKEGPALQEMQSVMNGLSDIQFQQILSIMNNKGTNQSSNPKGNAAGTSSGLSQTSLRLHRLVLDSGETDHITSSPNLLINSRQNTILPPIIMPSGEQAPITSIGTLPLNSVISLKNVLGVPSFKVYLMSDLTTKTTIGLGKQRATSTFAPPDPASLVQPPSSITPVQPLRRSQRHHSPPRALCDYVCNNVTSPKPSTSSSSGSTTALAANHTWSLTPLPPGKQPIGCRWVYKIKRRSDGTIERYKARLVAKGYTQLEALAAAQDWSLHQLDVNNAFLHGDLHEEIYVSASWSSATRGELVIQDAGYVQSKADYSLFTCRNGKSFTALLIYVDDILITGNDLKAISTLKQFLHSRFRIKDLGALKYFLGIEVSRSKKGISISQRKYTLEILKDGGILGAKPVNFPMEQNTKLSDTGLVVQCTTDYYVFLGSSLISWRTKRQKPVSLSSTEAEYRAMADTCYELSWLCSLLKDLRILHSKPTLLLCDNKAVLHITSNPVFHERTRHIEMDCHFIRDKIQDGSIVTKFVTSANQLADVFTKPLELLHAHINTRFMVFFSRKIRKKIIGNLPVRVLDLKKPETIRSHWNKKKEKGFGSCFRGKDTRNNFTSHLYSNLTQRGIKVYRDDSELERGKTIEPALWKAIEESRFSAIIFSRDYASSPWCLDELVKIVQCMKEKGQTVLPVFYDVDPSEVAEQKGKYKKAFVKHEQNFKENLEKVRNWKDCLSMVANLSGWDVRNRDESESIKAIADCISYKLSLTLPTISKELVGIDSRLEVLNGYIGEETGEAIFIGICGMGGIGKTTVARVLYDRIRRRFEGSCFLANVREAFAEKDGPRSLQKKLLSDILMERDINICDSSTGIEMIKQKLQRIKILVVLDDVNDRKQLEYLAKEPGWFGPGSRIIITSRDTNVLIGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEGFVELSKQVVDYANGLPLALEVIGSFLYERSIPEWRGAINRMNEIPDCKIIDVLRVSFDGLHESDKKIFLDIACFLKGFKKDRITRILESRGFHAGIGIPVLIERSLISVSRDQVWMHDLLQIMGKEIVRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKINNLQLSKGPEDLSNQLRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYGYKSAVNLKIINLSNSLNLSRTPDLTGIPNLESLILEGCTSLSKVHPSLGSHKNLQYVNLVNCESIRILPSNLEMESLKVFTLDGCSKLEKFPDVLGNMNCLMVLCLDETELKEWQHGSFSNIELSFHSSQPRVKVKNCGVCLLSSLYITSQPSSAHFIVTSKETASSYKASLTLSSSYHHWMASVFPDIRVADTSNAITYLKSDLARRVIISLNVKAIRSRLFKAIEESGLSIVIFSRDCASLPWCFDELVKIVGFMDEMRSDTVFPVSYDVEQSKIDDKKESYTIVFDKIGKNLRENKEKVQRWMDILSEVEISSELSSSESLTISELQQLLEQQEQVLEQEEQNLQQEEQQLQQLLDQQVLQQWRRQVLQPERRQLLQPERRQLQQEQRLRRRLRQLRLRRQLRQLRLLQQRRQLTGFWLVINLL

Domains

Domain Start-End Description Sequence

HMMPfam: PF14244
7-100 UBN2_3,gag-polypeptide of LTR copia-type

SKEGLVLVSKPLNGDNYSTWCRSMTISLNAKSKLGFIDGTIAMPSAKSQPDAHASWRKCNDMILSWILNSITPDLADTQMTVAAYYTKLKGLWD

superfamily: SSF56672
457-760 SSF56672

ANHTWSLTPLPPGKQPIGCRWVYKIKRRSDGTIERYKARLVAKGYTQLEALAAAQDWSLHQLDVNNAFLHGDLHEEIYVSASWSSATRGELVIQDAGYVQSKADYSLFTCRNGKSFTALLIYVDDILITGNDLKAISTLKQFLHSRFRIKDLGALKYFLGIEVSRSKKGISISQRKYTLEILKDGGILGAKPVNFPMEQNTKLSDTGLVVQCTTDYYVFLGSSLISWRTKRQKPVSLSSTEAEYRAMADTCYELSWLCSLLKDLRILHSKPTLLLCDNKAVLHITSNPVFHERTRHIEMDCHFI

HMMPfam: PF07727
IPR013103
458-538 RVT_2
Reverse transcriptase, RNA-dependent DNA polymeras

NHTWSLTPLPPGKQPIGCRWVYKIKRRSDGTIERYKARLVAKGYTQLEALAAAQDWSLHQLDVNNAFLHGDLHEEIYVSAS

HMMPfam: PF07727
IPR013103
548-656 RVT_2
Reverse transcriptase, RNA-dependent DNA polymeras

VIQDAGYVQSKADYSLFTCRNGKSFTALLIYVDDILITGNDLKAISTLKQFLHSRFRIKDLGALKYFLGIEVSRSKKGISISQRKYTLEILKDGGILGAKPVNFPMEQN

superfamily: SSF52200
IPR000157
826-980 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ETIRSHWNKKKEKGFGSCFRGKDTRNNFTSHLYSNLTQRGIKVYRDDSELERGKTIEPALWKAIEESRFSAIIFSRDYASSPWCLDELVKIVQCMKEKGQTVLPVFYDVDPSEVAEQKGKYKKAFVKHEQNFKENLEKVRNWKDCLSMVANLSGW

HMMPfam: PF01582
IPR000157
843-971 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CFRGKDTRNNFTSHLYSNLTQRGIKVYRDDSELERGKTIEPALWKAIEESRFSAIIFSRDYASSPWCLDELVKIVQCMKEKGQTVLPVFYDVDPSEVAEQKGKYKKAFVKHEQNFKENLEKVRNWKDCL

HMMSmart: SM00255
IPR000157
843-977 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CFRGKDTRNNFTSHLYSNLTQRGIKVYRDDSELERGKTIEPALWKAIEESRFSAIIFSRDYASSPWCLDELVKIVQCMKEKGQTVLPVFYDVDPSEVAEQKGKYKKAFVKHEQNFKENLEKVRNWKDCLSMVANL

Gene3D: G3DSA:3.40.50.10140
843-970 G3DSA:3.40.50.10140

CFRGKDTRNNFTSHLYSNLTQRGIKVYRDDSELERGKTIEPALWKAIEESRFSAIIFSRDYASSPWCLDELVKIVQCMKEKGQTVLPVFYDVDPSEVAEQKGKYKKAFVKHEQNFKENLEKVRNWKDC

ProfileScan: PS50104
IPR000157
844-977 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FRGKDTRNNFTSHLYSNLTQRGIKVYRDDSELERGKTIEPALWKAIEESRFSAIIFSRDYASSPWCLDELVKIVQCMKEKGQTVLPVFYDVDPSEVAEQKGKYKKAFVKHEQNFKENLEKVRNWKDCLSMVANL

HMMPanther: PTHR11017
862-1554 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TQRGIKVYRDDSELERGKTIEPALWKAIEESRFSAIIFSRDYASSPWCLDELVKIVQCMKEKGQTVLPVFYDVDPSEVAEQKGKYKKAFVKHEQNFKENLEKVRNWKDCLSMVANLSGWDVRNRDESESIKAIADCISYKLSLTLPTISKELVGIDSRLEVLNGYIGEETGEAIFIGICGMGGIGKTTVARVLYDRIRRRFEGSCFLANVREAFAEKDGPRSLQKKLLSDILMERDINICDSSTGIEMIKQKLQRIKILVVLDDVNDRKQLEYLAKEPGWFGPGSRIIITSRDTNVLIGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEGFVELSKQVVDYANGLPLALEVIGSFLYERSIPEWRGAINRMNEIPDCKIIDVLRVSFDGLHESDKKIFLDIACFLKGFKKDRITRILESRGFHAGIGIPVLIERSLISVSRDQVWMHDLLQIMGKEIVRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKINNLQLSKGPEDLSNQLRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYGYKSAVNLKIINLSNSLNLSRTPDLTGIPNLESLILEGCTSLSKVHPSLGSHKNLQYVNLVNCESIRILPSNLEMESLKVFTLDGCSKLEKFPDVLGNMNCLMVLCLDETELKEW

HMMPanther: PTHR11017:SF20
862-1554 PTHR11017:SF20,SUBFAMILY NOT NAMED

TQRGIKVYRDDSELERGKTIEPALWKAIEESRFSAIIFSRDYASSPWCLDELVKIVQCMKEKGQTVLPVFYDVDPSEVAEQKGKYKKAFVKHEQNFKENLEKVRNWKDCLSMVANLSGWDVRNRDESESIKAIADCISYKLSLTLPTISKELVGIDSRLEVLNGYIGEETGEAIFIGICGMGGIGKTTVARVLYDRIRRRFEGSCFLANVREAFAEKDGPRSLQKKLLSDILMERDINICDSSTGIEMIKQKLQRIKILVVLDDVNDRKQLEYLAKEPGWFGPGSRIIITSRDTNVLIGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEGFVELSKQVVDYANGLPLALEVIGSFLYERSIPEWRGAINRMNEIPDCKIIDVLRVSFDGLHESDKKIFLDIACFLKGFKKDRITRILESRGFHAGIGIPVLIERSLISVSRDQVWMHDLLQIMGKEIVRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKINNLQLSKGPEDLSNQLRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYGYKSAVNLKIINLSNSLNLSRTPDLTGIPNLESLILEGCTSLSKVHPSLGSHKNLQYVNLVNCESIRILPSNLEMESLKVFTLDGCSKLEKFPDVLGNMNCLMVLCLDETELKEW

superfamily: SSF52540
996-1243 SSF52540

DCISYKLSLTLPTISKELVGIDSRLEVLNGYIGEETGEAIFIGICGMGGIGKTTVARVLYDRIRRRFEGSCFLANVREAFAEKDGPRSLQKKLLSDILMERDINICDSSTGIEMIKQKLQRIKILVVLDDVNDRKQLEYLAKEPGWFGPGSRIIITSRDTNVLIGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEGFVELSKQVVDYANGLPLALEVIGSFLYERSIPEWRGAINRMNEIPDCKI

HMMPfam: PF00931
IPR002182
1026-1286 NB-ARC,NBS
NB-ARC

YIGEETGEAIFIGICGMGGIGKTTVARVLYDRIRRRFEGSCFLANVREAFAEKDGPRSLQKKLLSDILMERDINICDSSTGIEMIKQKLQRIKILVVLDDVNDRKQLEYLAKEPGWFGPGSRIIITSRDTNVLIGNDDTKIYEAEKLNDDDALMLFSQKAFKNDQPAEGFVELSKQVVDYANGLPLALEVIGSFLYERSIPEWRGAINRMNEIPDCKIIDVLRVSFDGLHESDKKIFLDIACFLKGFKKDRITRILESRGF

Gene3D: G3DSA:3.40.50.300
1032-1059 G3DSA:3.40.50.300

GEAIFIGICGMGGIGKTTVARVLYDRIR

FPrintScan: PR00364
IPR000767
1036-1051 DISEASERSIST
Disease resistance protein

FIGICGMGGIGKTTVA

FPrintScan: PR00364
IPR000767
1113-1127 DISEASERSIST
Disease resistance protein

KLQRIKILVVLDDVN

FPrintScan: PR00364
IPR000767
1206-1220 DISEASERSIST
Disease resistance protein

ANGLPLALEVIGSFL

superfamily: SSF46785
1241-1347 SSF46785

CKIIDVLRVSFDGLHESDKKIFLDIACFLKGFKKDRITRILESRGFHAGIGIPVLIERSLISVSRDQVWMHDLLQIMGKEIVRCESPEEPGRRSRLWTYEDVCLALM

superfamily: SSF52058
1321-1563 SSF52058,LRR

IVRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRLRLLKINNLQLSKGPEDLSNQLRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYGYKSAVNLKIINLSNSLNLSRTPDLTGIPNLESLILEGCTSLSKVHPSLGSHKNLQYVNLVNCESIRILPSNLEMESLKVFTLDGCSKLEKFPDVLGNMNCLMVLCLDETELKEWQHGSFSNIE

Gene3D: G3DSA:3.80.10.10
1372-1559 G3DSA:3.80.10.10

MKAFSKMSRLRLLKINNLQLSKGPEDLSNQLRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYGYKSAVNLKIINLSNSLNLSRTPDLTGIPNLESLILEGCTSLSKVHPSLGSHKNLQYVNLVNCESIRILPSNLEMESLKVFTLDGCSKLEKFPDVLGNMNCLMVLCLDETELKEWQHGSF

FPrintScan: PR00364
IPR000767
1512-1528 DISEASERSIST
Disease resistance protein

LEMESLKVFTLDGCSKL

superfamily: SSF52200
IPR000157
1611-1758 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SLTLSSSYHHWMASVFPDIRVADTSNAITYLKSDLARRVIISLNVKAIRSRLFKAIEESGLSIVIFSRDCASLPWCFDELVKIVGFMDEMRSDTVFPVSYDVEQSKIDDKKESYTIVFDKIGKNLRENKEKVQRWMDILSEVEISSEL

HMMSmart: SM00255
IPR000157
1617-1755 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SYHHWMASVFPDIRVADTSNAITYLKSDLARRVIISLNVKAIRSRLFKAIEESGLSIVIFSRDCASLPWCFDELVKIVGFMDEMRSDTVFPVSYDVEQSKIDDKKESYTIVFDKIGKNLRENKEKVQRWMDILSEVEIS

Gene3D: G3DSA:3.40.50.10140
1656-1747 G3DSA:3.40.50.10140

KAIRSRLFKAIEESGLSIVIFSRDCASLPWCFDELVKIVGFMDEMRSDTVFPVSYDVEQSKIDDKKESYTIVFDKIGKNLRENKEKVQRWMD

ProfileScan: PS50104
IPR000157
1656-1755 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KAIRSRLFKAIEESGLSIVIFSRDCASLPWCFDELVKIVGFMDEMRSDTVFPVSYDVEQSKIDDKKESYTIVFDKIGKNLRENKEKVQRWMDILSEVEIS

HMMPfam: PF01582
IPR000157
1657-1750 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AIRSRLFKAIEESGLSIVIFSRDCASLPWCFDELVKIVGFMDEMRSDTVFPVSYDVEQSKIDDKKESYTIVFDKIGKNLRENKEKVQRWMDILS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox