PRGDB00047149 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 57164474 (AC114983)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group chromosome 3 clone OSJNBa0032H19 map E30331S, complete sequence.

DNA Sequence

AATCCAAAGAATTATTCTTGCGGAGATTGTTTGGCCAGTTACATGAGTGCCCACAAAACATACAGAAAGTTTCAGAAAGCGTCTTGAAGAAATGCGGTGGTATGCCTCTAGCTATCAATAGTATAGCTGGGCTTTTGGCTTGTAGGCCTGTTAAGAGCTTAGAAGAAATGCAGAACTTACAAAACTCTCTTGGATCTGAGATGGATTCTTTCTCAACCATGGAGAAAATAAAGCAGATACTACTATTAAGTTACAATGATTTACCCTACCATTTGAAGACATGCTTCTTGTATTTTAGTATCTTCCCAGAGGACTACAAGATTAAAAGGAAAAATGTTGTCCGGCAATGGGTGGCAGAGGGATTTGTATCAGACAAGCGGGGACAATCTGCGGAGCAAGTTGCTGAGAGCTATTTTGCAGAGTTTATCAATAGGAGTATAGTCCAACCTTTAGATATAAGTGACAGCGGAAAGGTTAAGACTTGCAGGATCCATGATATAATGTTGGAGGTCATTGTAGAGATGTCTGTTGAACAAAATTTTATTTCACTTATGGGGGATCAACATACAATGATTTCCTATGACAAGGTTCGACGTCTTTCCTTACATGGCCATGGTGCATATAATCTATCAACTAGCTTGGAATTATCACATATCCGATCCCTAAGCTCCTTTGGGGATATGCCAAGAGCTTTGCGCTTTGACCGTGCAAGATTGCTCAGAGTGTTAGATCTAGAAAGCTGTGAATTTCTGAGGAATCGTCAACATCATCATATTTGTGCATTGTTCCATCTAAAGTACCTCAGTCTAAGAAGAGCTCACAACATAGATAGGCTCCCAAGAAAAATAAAGAAATTGCAGAGCTTGGAAACTCTAGATTTAAGGGGTAAAGGTATAGATAAGTTACCTGCTAGTTTCATTGAACTGGAGAATTTGGTCCATTTCCGTTCAGGTTCTACCTACTTGCCGCATGGCTTTGGGAGAATGAAAAGCATACTAACATTGGGATTGATAGAGATCTCAGATGACACATCTTGGAGGATACAAGAAATTGGCTGCTTGATGCAACTGGAGAAGCTCTGCATATGGTCACGCGATGGCATGAACAAGGAGAACTGGGAGTCCCTACTCACCGTCATTGAGAACTTAAGCAGGCGCCTCCTGTCACTCTCAATTGAAACGGACAGGAGAACTTGTTCTTTGCCACTTGATTTCTCATCCTCCCCACCTCTTCTCCTGCGAAGCCTCCTGTTATATGGAAGTTTGGAAGCATTGCCAAGTTGGATGGCATCGCTGGATAACCTTGTGAAATTAACTCTTGGTGGTACTAAATTAGAGGAGGATGATATACAGATTCTCCAGAAGCTCCCACGATTGTTTTCTCTTAGACTGTGGTTTGCATTTGCCGTAGAGAAGTTTGTTGTTGCGCCCTGAATGGAAAGTGTCGTTGTTACTGCTGCTGAGGGTGCTGTGAAAACACTGCTGGGTAAACTGGGCTCTTTTCTTTCGCAAGAGCCCCGACTTCTTGGTGGGGTCAGAGGTGAGTTGCAATACATCAAGGATGAACTTGAGAGCATGAACGCATTCCTCCAGAACCTTGCAGCCACAAGCAGCCACAGTGTCCAAGTGAAGATCTGGATGAAGCAAGTCAGAGAGATGGCTTATGACGCTGAGGACTGCATTGATGAGTTCCAACACCACTTTGGTGGCTATTGTGGTAATGGTATTGTAGGGTTTATATATAGGATGAAGCATCTTATGTACACTCTGAAGGTCCGCCATCGAATTGTCATGCAAGTGCAAGAGCTTAAGGTTCGTGCTCGAGATGTTAGTGACAGGTATGCGAGATATAGCGGTGCTAATGCTATTGTTGATGCCTCTGACTCGAAGAATACCACCACTTCAATCTCAACCTGTTTGTCCCTTGACCCTAGGCAAGTTATTGGTTTTATACAGGATGATCTACTTGTGGGAATCAACAATCGGAGGGACAGGGTCCTAACATATCTAAGAGTGGACAGTGATCAAGAACTAAGGGTAATATCAATTTTTGGCTTTGGAGGATTGGGCAAGACTACCCTTGCCAAGGCAATATATGATAGTCCACAGGTAAAGAATGGTCAGTTCCATTGTCAAGCTTTTGTTACCGTATCCCAGAAAATTGATCTAAAGGCTCTATTGAGAGACATGCTTGGGCAGCTTATTCCACCTGCTTCTGATCAACATGTCAGCTCAGACATTGAGGATGAACATCTCAAAGCTATTGAAGTATGGGATGTGAAAAGACTTGGCGACAAACTACGTTCATTATTCTTGATGATATTTG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa (japonica cultivar-group)].

MESVVVTAAEGAVKTLLGKLGSFLSQEPRLLGGVRGELQYIKDELESMNAFLQNLAATSSHSVQVKIWMKQVREMAYDAEDCIDEFQHHFGGYCGNGIVGFIYRMKHLMYTLKVRHRIVMQVQELKVRARDVSDRYARYSGANAIVDASDSKNTTTSISTCLSLDPRQVIGFIQDDLLVGINNRRDRVLTYLRVDSDQELRVISIFGFGGLGKTTLAKAIYDSPQVKNGQFHCQAFVTVSQKIDLKALLRDMLGQLIPPASDQHVSSDIEDEHLKAIEVWDVKRLGDKLRSLFLMIFESKELFLRRLFGQLHECPQNIQKVSESVLKKCGGMPLAINSIAGLLACRPVKSLEEMQNLQNSLGSEMDSFSTMEKIKQILLLSYNDLPYHLKTCFLYFSIFPEDYKIKRKNVVRQWVAEGFVSDKRGQSAEQVAESYFAEFINRSIVQPLDISDSGKVKTCRIHDIMLEVIVEMSVEQNFISLMGDQHTMISYDKVRRLSLHGHGAYNLSTSLELSHIRSLSSFGDMPRALRFDRARLLRVLDLESCEFLRNRQHHHICALFHLKYLSLRRAHNIDRLPRKIKKLQSLETLDLRGKGIDKLPASFIELENLVHFRSGSTYLPHGFGRMKSILTLGLIEISDDTSWRIQEIGCLMQLEKLCIWSRDGMNKENWESLLTVIENLSRRLLSLSIETDRRTCSLPLDFSSSPPLLLRSLLLYGSLEALPSWMASLDNLVKLTLGGTKLEEDDIQILQKLPRLFSLRLWFAFAVEKFVVAP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF150
9-762 PTHR23155:SF150,OS06G0158300 PROTEIN

AEGAVKTLLGKLGSFLSQEPRLLGGVRGELQYIKDELESMNAFLQNLAATSSHSVQVKIWMKQVREMAYDAEDCIDEFQHHFGGYCGNGIVGFIYRMKHLMYTLKVRHRIVMQVQELKVRARDVSDRYARYSGANAIVDASDSKNTTTSISTCLSLDPRQVIGFIQDDLLVGINNRRDRVLTYLRVDSDQELRVISIFGFGGLGKTTLAKAIYDSPQVKNGQFHCQAFVTVSQKIDLKALLRDMLGQLIPPASDQHVSSDIEDEHLKAIEVWDVKRLGDKLRSLFLMIFESKELFLRRLFGQLHECPQNIQKVSESVLKKCGGMPLAINSIAGLLACRPVKSLEEMQNLQNSLGSEMDSFSTMEKIKQILLLSYNDLPYHLKTCFLYFSIFPEDYKIKRKNVVRQWVAEGFVSDKRGQSAEQVAESYFAEFINRSIVQPLDISDSGKVKTCRIHDIMLEVIVEMSVEQNFISLMGDQHTMISYDKVRRLSLHGHGAYNLSTSLELSHIRSLSSFGDMPRALRFDRARLLRVLDLESCEFLRNRQHHHICALFHLKYLSLRRAHNIDRLPRKIKKLQSLETLDLRGKGIDKLPASFIELENLVHFRSGSTYLPHGFGRMKSILTLGLIEISDDTSWRIQEIGCLMQLEKLCIWSRDGMNKENWESLLTVIENLSRRLLSLSIETDRRTCSLPLDFSSSPPLLLRSLLLYGSLEALPSWMASLDNLVKLTLGGTKLEEDDIQILQKLPRLFSLRLW

HMMPanther: PTHR23155
9-762 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEGAVKTLLGKLGSFLSQEPRLLGGVRGELQYIKDELESMNAFLQNLAATSSHSVQVKIWMKQVREMAYDAEDCIDEFQHHFGGYCGNGIVGFIYRMKHLMYTLKVRHRIVMQVQELKVRARDVSDRYARYSGANAIVDASDSKNTTTSISTCLSLDPRQVIGFIQDDLLVGINNRRDRVLTYLRVDSDQELRVISIFGFGGLGKTTLAKAIYDSPQVKNGQFHCQAFVTVSQKIDLKALLRDMLGQLIPPASDQHVSSDIEDEHLKAIEVWDVKRLGDKLRSLFLMIFESKELFLRRLFGQLHECPQNIQKVSESVLKKCGGMPLAINSIAGLLACRPVKSLEEMQNLQNSLGSEMDSFSTMEKIKQILLLSYNDLPYHLKTCFLYFSIFPEDYKIKRKNVVRQWVAEGFVSDKRGQSAEQVAESYFAEFINRSIVQPLDISDSGKVKTCRIHDIMLEVIVEMSVEQNFISLMGDQHTMISYDKVRRLSLHGHGAYNLSTSLELSHIRSLSSFGDMPRALRFDRARLLRVLDLESCEFLRNRQHHHICALFHLKYLSLRRAHNIDRLPRKIKKLQSLETLDLRGKGIDKLPASFIELENLVHFRSGSTYLPHGFGRMKSILTLGLIEISDDTSWRIQEIGCLMQLEKLCIWSRDGMNKENWESLLTVIENLSRRLLSLSIETDRRTCSLPLDFSSSPPLLLRSLLLYGSLEALPSWMASLDNLVKLTLGGTKLEEDDIQILQKLPRLFSLRLW

superfamily: SSF52540
161-367 SSF52540

CLSLDPRQVIGFIQDDLLVGINNRRDRVLTYLRVDSDQELRVISIFGFGGLGKTTLAKAIYDSPQVKNGQFHCQAFVTVSQKIDLKALLRDMLGQLIPPASDQHVSSDIEDEHLKAIEVWDVKRLGDKLRSLFLMIFESKELFLRRLFGQLHECPQNIQKVSESVLKKCGGMPLAINSIAGLLACRPVKSLEEMQNLQNSLGSEMDS

HMMPfam: PF00931
IPR002182
186-273 NB-ARC,NBS
NB-ARC

DRVLTYLRVDSDQELRVISIFGFGGLGKTTLAKAIYDSPQVKNGQFHCQAFVTVSQKIDLKALLRDMLGQLIPPASDQHVSSDIEDEH

Gene3D: G3DSA:3.40.50.300
192-252 G3DSA:3.40.50.300

LRVDSDQELRVISIFGFGGLGKTTLAKAIYDSPQVKNGQFHCQAFVTVSQKIDLKALLRDM

FPrintScan: PR00364
IPR000767
202-217 DISEASERSIST
Disease resistance protein

VISIFGFGGLGKTTLA

Gene3D: G3DSA:3.40.50.300
272-332 G3DSA:3.40.50.300

EHLKAIEVWDVKRLGDKLRSLFLMIFESKELFLRRLFGQLHECPQNIQKVSESVLKKCGGM

HMMPfam: PF00931
IPR002182
294-422 NB-ARC,NBS
NB-ARC

LMIFESKELFLRRLFGQLHECPQNIQKVSESVLKKCGGMPLAINSIAGLLACRPVKSLEEMQNLQNSLGSEMDSFSTMEKIKQILLLSYNDLPYHLKTCFLYFSIFPEDYKIKRKNVVRQWVAEGFVSD

FPrintScan: PR00364
IPR000767
329-343 DISEASERSIST
Disease resistance protein

CGGMPLAINSIAGLL

Gene3D: G3DSA:3.80.10.10
492-637 G3DSA:3.80.10.10

DKVRRLSLHGHGAYNLSTSLELSHIRSLSSFGDMPRALRFDRARLLRVLDLESCEFLRNRQHHHICALFHLKYLSLRRAHNIDRLPRKIKKLQSLETLDLRGKGIDKLPASFIELENLVHFRSGSTYLPHGFGRMKSILTLGLIEI

superfamily: SSF52047
492-762 SSF52047,LRR

DKVRRLSLHGHGAYNLSTSLELSHIRSLSSFGDMPRALRFDRARLLRVLDLESCEFLRNRQHHHICALFHLKYLSLRRAHNIDRLPRKIKKLQSLETLDLRGKGIDKLPASFIELENLVHFRSGSTYLPHGFGRMKSILTLGLIEISDDTSWRIQEIGCLMQLEKLCIWSRDGMNKENWESLLTVIENLSRRLLSLSIETDRRTCSLPLDFSSSPPLLLRSLLLYGSLEALPSWMASLDNLVKLTLGGTKLEEDDIQILQKLPRLFSLRLW

FPrintScan: PR00364
IPR000767
532-548 DISEASERSIST
Disease resistance protein

DRARLLRVLDLESCEFL

Gene3D: G3DSA:3.80.10.10
718-761 G3DSA:3.80.10.10

SLEALPSWMASLDNLVKLTLGGTKLEEDDIQILQKLPRLFSLRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox