PRGDB00047150 (OJ1003C07.16)

From PRG Wiki
Jump to: navigation, search
OJ1003C07.16
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 19033428 (AC113335)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Genomic sequence for Oryza sativa (japonica cultivar-group) cultivar Nipponbare clone OJ1003C07, from chromosome 10, complete sequence.

DNA Sequence

ATGGAGGCCCCGCCCCTCGCCGCCCCGATTTGTGCTTCACAGGGAGCCATGGGATCCCTTCTTGGGAAGATGGAGGAGCTGCTTGTGGCTCCCGATGGCAGCAGGCTACCCAAGGGGGTGAAGGATCGGATGCTCCTCCTGGGAGGCGACCTTGGAGTGGTCGCCGCGTACCTCGCCGATCTGTCGGAGCTGGAGGACCCTCCCCCGACGGCCAAGCGCTGGATGAGAGAGGTGCGCGAGCTGTCCTACGACATCGAGGACTACATCGACGAGTTCTGCGCAGCGCCGCGGCCTGGCCGCCGCGCGAACACCATGGCCAGATTCGTCTGCAGAATCGGCCGTGTCAAGGTTGCTCGTCTTCCCAAGAGGCTCAAGAGGCACCAGCAGATGGGGAAGATGGTGTCGCAGTTCAGGATTTATGTTGAGGAGGCCATTGAGCGGCATGGGAGGTATGGTCTGGATTGCTGCGACCACAGGCGGAGATATGTGTCATTTGGCCCTATGTTGCCATCTAGGCCGTATGGGGAAGAAGATGCCCAGCTAGTGATTGATGGCCGGGTGAGCGAGTTCATCGAGCGGCTCGCCAATGATGAGGATCAGAAGCTCAAGGTGGTGTCTGTTGTTGGATCTTCAGGTATTGGTAAGACCACACTTGCCAAACTGTTGTACAACAGAATTGGGGGACAATTTGACTGTCGAGCTTTCGTCCGGATCTCCCGGAAGCCTGATATGAAGAGGGTTTTCCGCGAGATGTTCTTTCAACTCCAGCGGAAGCAGCCACCTGACGATTATAAGGAGCTTGCGCTTATTGACAGCATCAGGGAGTATCTTCAAGATAGAAGGTATTTAATTATTATTGATGACTTATGGGCTGCCTCCGTATGGGATCTTATCAATCAAGCTTTTCCAGAGACATGCTTGCTATATCTTAATATGTATCCAGAGGGTTATAAAATATGCAAGGATGATGTTGTGGAAAAATGGGTGGCTGAAGGTTTTATTGATCAAATAGAGGGCCGAGACTTGGAGAAAGTTGCAGGGAGCTATTTCGATGAACTTATTGACAGAAGATTCCTCCAACCTAGCAGACTCAACTACAACAATGAGGTGTCAACTTGTACAATTCATGATGAGGTACGAGATCTTATTGCATACAAGTCTGTAGAGGAGAACTTTGTTCTGGTATTAGATTTTTACCGGAAGGATGTGGAACTTTCTGATAAAGTTCGTCGACTTTCTGTCCACTTTGGTGACATAAAGTATGCAAAAATACCAACAAACATCAGAACATCAGAAGTTCGATCACTTACATTTTTTGGATTATGTAAGTGTATGCCTTCTCTTACAGAGTTTAAGCTTCTTCGTGTTCTAAACCTTCAATTATCTGGTCATGTTGGTGATGAACTCTTAGACCTCAGTGGGATTTCTGAACTATTTCAACTGAGATATTTGAAGATTGCATGCGATATTCGCACAGAACTACCAAGCCAAATGCGAGGGCTAAAATATTTAGAAACGTTGCAGATGGATACAACACTCACTGCTGTTCCTTGGGATATTATCTTTCTCCCGTGCTTGTTACACCTCCATCTTCGTTTTGATATGAATCTGATTGATTTGATGGGCCACATGACACCTCCCAGCGAACTAGGATCAAGCAGTAGTAACTCATCACCCAGTGGGGGCATCATTAGCAATCTGAACAACGTACGGGATATTCATCTCACCTTCTGTGCACTGCCTTCCAAACATCTAGAGAGAAACATGGAAATTTTGGGCTCTTTGCTTGGAAGACTTGGTAATCTGAAAAATCTAACTCTAGTTTCTTCTTCCTCTCAAAAGAAAATTGCGGCTTCAGGAGCCTCAGAAGTAACTATTTTGTGGGATAATTTGGCACCTCCACCTCTTCTCCAGAGATTTGAGTGGTTGCTGCACAGCTGCATCTTTTACAGAGTTCCTAAGTGGATTGGAGAACTTGGCAACCTATGCATTTTAAAGATTGCAGTAAGGGAGCTTGTAAAGAACAGTGTTGATATTCTCAGGGGATTGCCTGCCCTCATGGCTCTATCTTTGAATGTGCACAGAGCATCTGTAGAAAACATTTTCTTTGATAAGGTAGGATTCTCAGTTCTCAAGTACTTCAAGTATAATTGTAGTGTACCTTGGCTGAAATTTGAGGCAGGGGCAATGCCTAATCTCAGGAAGCTCAAGTTAGGTTTCAGTGCCCTTGGGGATCTATATGGTACTGCACCTATCAGGATTGGACACTTGTTAGGCCTCAAAGAAATCTCAGTAAAAATTCATGGTGCAAGTGTCGACGCAGAGTCTGCATTGACATCTGCTGTTAGCAATCACCCAAGCAATCCTAGAATCAACGTACAGTTGGTGGATAAGATTTTTTATGGTGATAGAGTGACAAAAGAGAAAGATCATGGGTCTGAGGAAGAACAAAATGCTATCATGAGCGCCAACTTCGATGAATATCATCAAACTCAAGATAAAGAGTCAAGTGATGCGAACAAACAAGTTGGAAGTATTGTGCCTCTGCCACGGGAGCAAGAACATGGGATTTTAGAACATGATGAGTATGCACCAAAAGACCCAGATAAGTACAAACAATCTGATATCAGGTCTGTATCATCAATGTATCCGTGGCATCTGAAGTTTCTAGAAACATTAGCATTTTGTACATAA


Protein sequences

Name Description Sequence
Putative disease resistance protein Putative disease resistance protein [Oryza sativa (japonica cultivar-group)].

MEAPPLAAPICASQGAMGSLLGKMEELLVAPDGSRLPKGVKDRMLLLGGDLGVVAAYLADLSELEDPPPTAKRWMREVRELSYDIEDYIDEFCAAPRPGRRANTMARFVCRIGRVKVARLPKRLKRHQQMGKMVSQFRIYVEEAIERHGRYGLDCCDHRRRYVSFGPMLPSRPYGEEDAQLVIDGRVSEFIERLANDEDQKLKVVSVVGSSGIGKTTLAKLLYNRIGGQFDCRAFVRISRKPDMKRVFREMFFQLQRKQPPDDYKELALIDSIREYLQDRRYLIIIDDLWAASVWDLINQAFPETCLLYLNMYPEGYKICKDDVVEKWVAEGFIDQIEGRDLEKVAGSYFDELIDRRFLQPSRLNYNNEVSTCTIHDEVRDLIAYKSVEENFVLVLDFYRKDVELSDKVRRLSVHFGDIKYAKIPTNIRTSEVRSLTFFGLCKCMPSLTEFKLLRVLNLQLSGHVGDELLDLSGISELFQLRYLKIACDIRTELPSQMRGLKYLETLQMDTTLTAVPWDIIFLPCLLHLHLRFDMNLIDLMGHMTPPSELGSSSSNSSPSGGIISNLNNVRDIHLTFCALPSKHLERNMEILGSLLGRLGNLKNLTLVSSSSQKKIAASGASEVTILWDNLAPPPLLQRFEWLLHSCIFYRVPKWIGELGNLCILKIAVRELVKNSVDILRGLPALMALSLNVHRASVENIFFDKVGFSVLKYFKYNCSVPWLKFEAGAMPNLRKLKLGFSALGDLYGTAPIRIGHLLGLKEISVKIHGASVDAESALTSAVSNHPSNPRINVQLVDKIFYGDRVTKEKDHGSEEEQNAIMSANFDEYHQTQDKESSDANKQVGSIVPLPREQEHGILEHDEYAPKDPDKYKQSDIRSVSSMYPWHLKFLETLAFCT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF196
15-808 PTHR23155:SF196,OS11G0225300 PROTEIN

GAMGSLLGKMEELLVAPDGSRLPKGVKDRMLLLGGDLGVVAAYLADLSELEDPPPTAKRWMREVRELSYDIEDYIDEFCAAPRPGRRANTMARFVCRIGRVKVARLPKRLKRHQQMGKMVSQFRIYVEEAIERHGRYGLDCCDHRRRYVSFGPMLPSRPYGEEDAQLVIDGRVSEFIERLANDEDQKLKVVSVVGSSGIGKTTLAKLLYNRIGGQFDCRAFVRISRKPDMKRVFREMFFQLQRKQPPDDYKELALIDSIREYLQDRRYLIIIDDLWAASVWDLINQAFPETCLLYLNMYPEGYKICKDDVVEKWVAEGFIDQIEGRDLEKVAGSYFDELIDRRFLQPSRLNYNNEVSTCTIHDEVRDLIAYKSVEENFVLVLDFYRKDVELSDKVRRLSVHFGDIKYAKIPTNIRTSEVRSLTFFGLCKCMPSLTEFKLLRVLNLQLSGHVGDELLDLSGISELFQLRYLKIACDIRTELPSQMRGLKYLETLQMDTTLTAVPWDIIFLPCLLHLHLRFDMNLIDLMGHMTPPSELGSSSSNSSPSGGIISNLNNVRDIHLTFCALPSKHLERNMEILGSLLGRLGNLKNLTLVSSSSQKKIAASGASEVTILWDNLAPPPLLQRFEWLLHSCIFYRVPKWIGELGNLCILKIAVRELVKNSVDILRGLPALMALSLNVHRASVENIFFDKVGFSVLKYFKYNCSVPWLKFEAGAMPNLRKLKLGFSALGDLYGTAPIRIGHLLGLKEISVKIHGASVDAESALTSAVSNHPSNPRINVQLVDKIFYGDRVTKE

HMMPanther: PTHR23155
15-808 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GAMGSLLGKMEELLVAPDGSRLPKGVKDRMLLLGGDLGVVAAYLADLSELEDPPPTAKRWMREVRELSYDIEDYIDEFCAAPRPGRRANTMARFVCRIGRVKVARLPKRLKRHQQMGKMVSQFRIYVEEAIERHGRYGLDCCDHRRRYVSFGPMLPSRPYGEEDAQLVIDGRVSEFIERLANDEDQKLKVVSVVGSSGIGKTTLAKLLYNRIGGQFDCRAFVRISRKPDMKRVFREMFFQLQRKQPPDDYKELALIDSIREYLQDRRYLIIIDDLWAASVWDLINQAFPETCLLYLNMYPEGYKICKDDVVEKWVAEGFIDQIEGRDLEKVAGSYFDELIDRRFLQPSRLNYNNEVSTCTIHDEVRDLIAYKSVEENFVLVLDFYRKDVELSDKVRRLSVHFGDIKYAKIPTNIRTSEVRSLTFFGLCKCMPSLTEFKLLRVLNLQLSGHVGDELLDLSGISELFQLRYLKIACDIRTELPSQMRGLKYLETLQMDTTLTAVPWDIIFLPCLLHLHLRFDMNLIDLMGHMTPPSELGSSSSNSSPSGGIISNLNNVRDIHLTFCALPSKHLERNMEILGSLLGRLGNLKNLTLVSSSSQKKIAASGASEVTILWDNLAPPPLLQRFEWLLHSCIFYRVPKWIGELGNLCILKIAVRELVKNSVDILRGLPALMALSLNVHRASVENIFFDKVGFSVLKYFKYNCSVPWLKFEAGAMPNLRKLKLGFSALGDLYGTAPIRIGHLLGLKEISVKIHGASVDAESALTSAVSNHPSNPRINVQLVDKIFYGDRVTKE

superfamily: SSF52540
163-304 SSF52540

VSFGPMLPSRPYGEEDAQLVIDGRVSEFIERLANDEDQKLKVVSVVGSSGIGKTTLAKLLYNRIGGQFDCRAFVRISRKPDMKRVFREMFFQLQRKQPPDDYKELALIDSIREYLQDRRYLIIIDDLWAASVWDLINQAFPE

HMMPfam: PF00931
IPR002182
186-304 NB-ARC,NBS
NB-ARC

RVSEFIERLANDEDQKLKVVSVVGSSGIGKTTLAKLLYNRIGGQFDCRAFVRISRKPDMKRVFREMFFQLQRKQPPDDYKELALIDSIREYLQDRRYLIIIDDLWAASVWDLINQAFPE

Gene3D: G3DSA:3.40.50.300
187-292 G3DSA:3.40.50.300

VSEFIERLANDEDQKLKVVSVVGSSGIGKTTLAKLLYNRIGGQFDCRAFVRISRKPDMKRVFREMFFQLQRKQPPDDYKELALIDSIREYLQDRRYLIIIDDLWAA

FPrintScan: PR00364
IPR000767
204-219 DISEASERSIST
Disease resistance protein

VVSVVGSSGIGKTTLA

FPrintScan: PR00364
IPR000767
276-290 DISEASERSIST
Disease resistance protein

YLQDRRYLIIIDDLW

superfamily: SSF52058
374-765 SSF52058,LRR

TIHDEVRDLIAYKSVEENFVLVLDFYRKDVELSDKVRRLSVHFGDIKYAKIPTNIRTSEVRSLTFFGLCKCMPSLTEFKLLRVLNLQLSGHVGDELLDLSGISELFQLRYLKIACDIRTELPSQMRGLKYLETLQMDTTLTAVPWDIIFLPCLLHLHLRFDMNLIDLMGHMTPPSELGSSSSNSSPSGGIISNLNNVRDIHLTFCALPSKHLERNMEILGSLLGRLGNLKNLTLVSSSSQKKIAASGASEVTILWDNLAPPPLLQRFEWLLHSCIFYRVPKWIGELGNLCILKIAVRELVKNSVDILRGLPALMALSLNVHRASVENIFFDKVGFSVLKYFKYNCSVPWLKFEAGAMPNLRKLKLGFSALGDLYGTAPIRIGHLLGLKEISV

Gene3D: G3DSA:3.80.10.10
470-583 G3DSA:3.80.10.10

LDLSGISELFQLRYLKIACDIRTELPSQMRGLKYLETLQMDTTLTAVPWDIIFLPCLLHLHLRFDMNLIDLMGHMTPPSELGSSSSNSSPSGGIISNLNNVRDIHLTFCALPSK

FPrintScan: PR00364
IPR000767
582-596 DISEASERSIST
Disease resistance protein

SKHLERNMEILGSLL

Gene3D: G3DSA:3.80.10.10
653-748 G3DSA:3.80.10.10

PKWIGELGNLCILKIAVRELVKNSVDILRGLPALMALSLNVHRASVENIFFDKVGFSVLKYFKYNCSVPWLKFEAGAMPNLRKLKLGFSALGDLYG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox