PRGDB00047151 (OSJNBa0091J06.22)

From PRG Wiki
Jump to: navigation, search
OSJNBa0091J06.22
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 19033431 (AC113338)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) cultivar Nipponbare clone OSJNBa0091J06 from chromosome 10, complete sequence.

DNA Sequence

ATGCCGCATCCCAATATTGCTGCTAGCTGCTCCCCCTCCTGCTTGCTCCTCGCCGTAGCCGTCACCTTCTTCTCGGCTACAGCCAGCATCTCCCATGGCGCCGCCCATCACGCGCGGCGCGTGCCCGCACCGCCGGCGGCGTGCGTGGCGCGCGAGAGGGACGCGCTGCTGGCCTTCAAGCAGCGCGTCACCGCGCGCGACCCAGCGAGCGCTATCTCGTCGTGGCGGCGAGGGGAGGCCGCTGCAGACTGCTGCCAGTGGGACGGTGTCGAGTGCGACAGCCGCACCGGCCGTGTCATCGGCCTCGACCTCGCCAATCGCGAGTTCGATGGTAGGACGGGCGTGCTCGATGACCAGGTGTCTCTTGTTGGTGACATAAGCCGCTCTTTGCTCTCTCTGGAGCACCTGAGTGACCTCCAACTCGGCTGGAATTTCCTGGAGGGGCGCACTGGTCGTCTCCCGGACTTCCTTGGCTCTTTCAAAAGGCTGGAATCTCTTGGCCTCACCGGCATACCATTTTCTGGCACCGTGCCTCCTAAGCTCGGAATTCCGCAGTGA


Protein sequences

Name Description Sequence
Putative disease resistance protein Putative disease resistance protein [Oryza sativa (japonica cultivar-group)].

MPHPNIAASCSPSCLLLAVAVTFFSATASISHGAAHHARRVPAPPAACVARERDALLAFKQRVTARDPASAISSWRRGEAAADCCQWDGVECDSRTGRVIGLDLANREFDGRTGVLDDQVSLVGDISRSLLSLEHLSDLQLGWNFLEGRTGRLPDFLGSFKRLESLGLTGIPFSGTVPPKLGIPQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-182 PTHR24420,FAMILY NOT NAMED

MPHPNIAASCSPSCLLLAVAVTFFSATASISHGAAHHARRVPAPPAACVARERDALLAFKQRVTARDPASAISSWRRGEAAADCCQWDGVECDSRTGRVIGLDLANREFDGRTGVLDDQVSLVGDISRSLLSLEHLSDLQLGWNFLEGRTGRLPDFLGSFKRLESLGLTGIPFSGTVPPKLG

superfamily: SSF52058
46-182 SSF52058,LRR

AACVARERDALLAFKQRVTARDPASAISSWRRGEAAADCCQWDGVECDSRTGRVIGLDLANREFDGRTGVLDDQVSLVGDISRSLLSLEHLSDLQLGWNFLEGRTGRLPDFLGSFKRLESLGLTGIPFSGTVPPKLG

Gene3D: G3DSA:3.80.10.10
47-181 G3DSA:3.80.10.10

ACVARERDALLAFKQRVTARDPASAISSWRRGEAAADCCQWDGVECDSRTGRVIGLDLANREFDGRTGVLDDQVSLVGDISRSLLSLEHLSDLQLGWNFLEGRTGRLPDFLGSFKRLESLGLTGIPFSGTVPPKL

HMMPfam: PF08263
IPR013210
51-93 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

RERDALLAFKQRVTARDPASAISSWRRGEAAADCCQWDGVECD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox