PRGDB00047153 (OSJNBb0058B20.30)

From PRG Wiki
Jump to: navigation, search
OSJNBb0058B20.30
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18464047 (AC108884)
Gene Class Unknown
Domain Type
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) cultivar Nipponbare clone OSJNBb0058B20 from chromosome 10, complete sequence.

DNA Sequence

ATGGCGGCATCTCACCGTGCAATCCTAGCCCTGATCCTCCTCTTCAGCTCGTCGGCGGCGACAATCGCGGCGGCGCAGCCGGCCGCGGCAGACGGCGGGAGGACGACGCACCTCCACTTCTACATGCACGAGTTCTTCAACGGCGGGCCGAACGGCTCGATGGCCAGGGTGGCCCCGCCGGCGCGCAGCGGCGGCTCGCTGTTCGGCTTCGTCAGCGTGGTCGACGACGCGCTCCGCGAGGGCGCCGACCCGGCGTCCCGCCTGGTCGGGCGCGCGCAGGGGCTCGCCGCCGGCACGTCGCTCGCCGACGGCTCGGTCACGACGATGCTGGACTTCGTGTTCACGGACGGCCGTACAAGGGCAGCACGGTGGCGGCGTTCGGCGTCGGGCTGCCGCTGCCCGGCGGCGCGGCGATGGAGCGGCCGGTGGTCGGCGGCACGGGCGCGTTCCGGATGGCGCGAGGGTACACGCTCAGCAGGACGGTGA


Protein sequences

Name Description Sequence
Putative disease resistance protein Putative disease resistance protein [Oryza sativa (japonica cultivar-group)].

MAASHRAILALILLFSSSAATIAAAQPAAADGGRTTHLHFYMHEFFNGGPNGSMARVAPPARSGGSLFGFVSVVDDALREGADPASRLVGRAQGLAAGTSLADGSVTTMLDFVFTDGRTRAARWRRSASGCRCPAARRWSGRWSAARARSGWREGTRSAGR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21495
4-120 FAMILY NOT NAMED,NUCLEOPORIN-RELATED

SHRAILALILLFSSSAATIAAAQPAAADGGRTTHLHFYMHEFFNGGPNGSMARVAPPARSGGSLFGFVSVVDDALREGADPASRLVGRAQGLAAGTSLADGSVTTMLDFVFTDGRTR

Seg: seg
7-30 seg

AILALILLFSSSAATIAAAQPAAA

HMMPfam: PF03018
IPR004265
35-120 Dirigent
Plant disease resistance response protein

TTHLHFYMHEFFNGGPNGSMARVAPPARSGGSLFGFVSVVDDALREGADPASRLVGRAQGLAAGTSLADGSVTTMLDFVFTDGRTR

Seg: seg
117-133 seg

GRTRAARWRRSASGCRC

Seg: seg
135-153 seg

AARRWSGRWSAARARSGWR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox