PRGDB00047198 (Cf2/Cf5-like disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Cf2/Cf5-like disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 190688725 (EU810765)
Gene Class RLP
Domain Type LRR, LRR, LRR, Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor clone BAC Sbb12448, complete sequence.

DNA Sequence

ATGTGCCTCCTGCTCTTTTTCCTCCTAGCACCATCCACCACCATCGCCGCTTCGTCTCTCTCGAGTGTAGCGAAGAAGTTCAATGGCAGCTGCATCACGGCCGAGAAGGAGGCGTTACTATCCTTCAAAGCCGGCATCACCAGTGACCCCAGCGGGCGGCTGAGATCGTGGCGAGGCCAAGACTGCTGCCGGTGGCACGGCGTGAGGTGCAGCACCAGGACAGGCCACATCGTGAAGCTCGACCTGCACAACGATTTCTTCAAAGAGGATGTATCCAGTGAGGACCAAGAAGATTTACTATCTTCAGAGAACCATGTTGTTCGTTGGCTGCGCGGGAAGATAAGCTCATCTCTTCTTCAACTACGCCGTCTTAAGCATCTTGATCTTAGCGGAAATATGCTTGGAGGCGATATGGCGCCTATACCGGAATTTATGGGCTCTCTTAAGAGTTTGACACATCTCAACCTCTCAAACATGAAGTTCTTCGGTCGCGTACCTCCTCAGCTAGGCAACCTCACAAGACTGGTATACCTCGACATTCACACCGATTACTTTCATTTCTTTGCATATTCACCGGATGTCTCATGGTTAGAAAACCTTCATTCACTAGAGCATCTTGACATGGGATATGTGAACCTGAGTGCGGCGGTTAATTGGATTCATTCAGTCAACACCCTCCCAAATTTGAGAGTACTGCACCTCAGCTTTTGTGGACTTAGTAGCTCCATCCCATCACTTCAACACCATAACCTTACGGTTCTTGAGAGACTTGACCTCTCCCTTAATCCTTTTAACACTCCCGTTGCACCCAATTGGTACTGGGATGTCACTAGCCTCAAGAGTCTAAGCATAGGTGCTTGTGAATTGTCTGGCCCCTTTCCAGATGAGCTAGGGAACTTGACCATGTTAGAGACCCTTGAAATGGGTAACAAAAACATCAACGGGATGATACCATCAACACTAAAAAACATGTGCAACTTGCGGATGATAGACCTCATTGGTGTCAACGTCGGTGGGGATATAACAGATCTAATAGAGAGGCTACCAAATTGTTCATGGAATACTTTGCAAGAGCTACTGTTGGAGGAGACAAACATCACCGGAACAACACTAAAATCACTACTCAACCTCACTGCCTTAAGCATACTTGGCATCGGCTACAACGACTTAAGAGGTTCTGTGCCTGTGGAAATTGGAACATTAAAAAATCTGACCAAGTTGTACGTTGCCTCTAGTAGCTTGAGCGGTGTGATATCAGAAGATCATTTCTCTAGTTTGACAAATTTGAAGGAAATTTACCTATCTCAGACATATCTACAAGTCATTGTGGGTTCACATTGGGAACCCCCATTCAACTTGCACAAGGCATATTTTTCATCTGTTCATTTGGGTCCCCAAGTTCCTAATTGGCTTCGATGGCAATCGAGCATTTCAGAGCTTGACATTTCAGACACAGGTCTCACTGGTAGGATTCCAAATTGGTTTTGGACTACATTTTCTAATGCCAGGCACTTGGACCTCTCTTATAACCAAATTAGTGGTGGATTACCACATAATTTGGAATTCATGTCAGTGAAAGCCCTTCAACTCCAATCAAATAATTTAACTGGTTCAGTACCACGGTTACCAAGAAGCATTGTTACATTTGACTTGTCCAATAATTCTTTAAGTGGAGAACTACCATCAAATTTTGGAGGTCCAAATTTACGGGTTGCAGTTCTATTTTCCAATCGTATAACCGGGATCATTCCAGACTCAATTTGTCAATGGCCTCAACTCCAGATCTTAGATCTTTCAAACAACCTACTTACAAGAGGACTACCTGATTGTGGAAGAGAAAAGTTGAAACAACATTATGCATCTATCAACAACTCTTCCAGGATCAATTCTGCAATTCCTTACGGTTTCAAAATCCACACCCTGCTTCTAAAGAACAACAACCTTTCAGGTGGATTTCCTGTTTTCTTGAAACAAGGCAAAAAACTTAAGTTCCTCGATCTAACTCAAAACAGATTTAGTGGGAAGTTACCTGCATGGATAAGTGAGAACATGCCTACATTGGTAATTCTACGTTTAAGATCTAACAACTTCTCTGGTCAAATTCCAATTGAAACTATGCAGCTTTTCTCTCTTCATATTCTTGATCTAGCAAATAACACTTTTTCTGGGGTTATACCACAGTCCCTTAAGAACTTGAAAGCTCTGACTACCACTGTTGTGGGTTCCGATGGAATTGATTATCCTTTCACAGAAGAATATCAGTTTGATGATATAGTATATGATACCGATATGCTAAATGACGATAGCTTTTCATTGGTAATTAAAGGGCAAGTGCTTGACTATACAGGGAATGCCTTACTTGTGACGAGCATTGACCTATCTTGCAATAGATTAGCCGGGTCAATCCCAAAAGAAATAGCTTCACTTCTTGGCCTAGTAAATCTGAATTTATCATGGAACTTCTTGAGTGGAAATATCCCAGATATGATCGGCAATCTGCAAGCTTTGGAGGCTCTTGACTTGTCCAACAACCAACTTTATGGTGAAATTCCTTGGTGCTTGTCAAATTTGACTTCTCTGAGCTATATGAATGTTTCCTACAATAACCTATCAGGCAGAATACCCTCAGGAAATCAACTAGACATTCTCAGGGCAGATGATCCTGCTTCGATTTACATTGGCAATCCAGGTCTTTGTGGGCATCCACTTCCAAAACTTTGTCCTGGAGATGAACCAACACAAGATTGCAGTAGCTGCCATGAAGATGACAACACTCAAATGGATTTTCATCTGGGTTTAACCGTTGGATTCATTGTAGGCGTTTGGATAATATTTTGTAGCCTTTTATTTAAGAAGGCTTGGAGGTACACCTACTTTAGCCTATTTGACAAAGTGTATGACAAGGTGTGGAAGAAATAA


Protein sequences

Name Description Sequence
Cf2/Cf5-like disease resistance protein Cf2/Cf5-like disease resistance protein [Sorghum bicolor].

MCLLLFFLLAPSTTIAASSLSSVAKKFNGSCITAEKEALLSFKAGITSDPSGRLRSWRGQDCCRWHGVRCSTRTGHIVKLDLHNDFFKEDVSSEDQEDLLSSENHVVRWLRGKISSSLLQLRRLKHLDLSGNMLGGDMAPIPEFMGSLKSLTHLNLSNMKFFGRVPPQLGNLTRLVYLDIHTDYFHFFAYSPDVSWLENLHSLEHLDMGYVNLSAAVNWIHSVNTLPNLRVLHLSFCGLSSSIPSLQHHNLTVLERLDLSLNPFNTPVAPNWYWDVTSLKSLSIGACELSGPFPDELGNLTMLETLEMGNKNINGMIPSTLKNMCNLRMIDLIGVNVGGDITDLIERLPNCSWNTLQELLLEETNITGTTLKSLLNLTALSILGIGYNDLRGSVPVEIGTLKNLTKLYVASSSLSGVISEDHFSSLTNLKEIYLSQTYLQVIVGSHWEPPFNLHKAYFSSVHLGPQVPNWLRWQSSISELDISDTGLTGRIPNWFWTTFSNARHLDLSYNQISGGLPHNLEFMSVKALQLQSNNLTGSVPRLPRSIVTFDLSNNSLSGELPSNFGGPNLRVAVLFSNRITGIIPDSICQWPQLQILDLSNNLLTRGLPDCGREKLKQHYASINNSSRINSAIPYGFKIHTLLLKNNNLSGGFPVFLKQGKKLKFLDLTQNRFSGKLPAWISENMPTLVILRLRSNNFSGQIPIETMQLFSLHILDLANNTFSGVIPQSLKNLKALTTTVVGSDGIDYPFTEEYQFDDIVYDTDMLNDDSFSLVIKGQVLDYTGNALLVTSIDLSCNRLAGSIPKEIASLLGLVNLNLSWNFLSGNIPDMIGNLQALEALDLSNNQLYGEIPWCLSNLTSLSYMNVSYNNLSGRIPSGNQLDILRADDPASIYIGNPGLCGHPLPKLCPGDEPTQDCSSCHEDDNTQMDFHLGLTVGFIVGVWIIFCSLLFKKAWRYTYFSLFDKVYDKVWKK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF516
7-970 PTHR26393:SF516

FLLAPSTTIAASSLSSVAKKFNGSCITAEKEALLSFKAGITSDPSGRLRSWRGQDCCRWHGVRCSTRTGHIVKLDLHNDFFKEDVSSEDQEDLLSSENHVVRWLRGKISSSLLQLRRLKHLDLSGNMLGGDMAPIPEFMGSLKSLTHLNLSNMKFFGRVPPQLGNLTRLVYLDIHTDYFHFFAYSPDVSWLENLHSLEHLDMGYVNLSAAVNWIHSVNTLPNLRVLHLSFCGLSSSIPSLQHHNLTVLERLDLSLNPFNTPVAPNWYWDVTSLKSLSIGACELSGPFPDELGNLTMLETLEMGNKNINGMIPSTLKNMCNLRMIDLIGVNVGGDITDLIERLPNCSWNTLQELLLEETNITGTTLKSLLNLTALSILGIGYNDLRGSVPVEIGTLKNLTKLYVASSSLSGVISEDHFSSLTNLKEIYLSQTYLQVIVGSHWEPPFNLHKAYFSSVHLGPQVPNWLRWQSSISELDISDTGLTGRIPNWFWTTFSNARHLDLSYNQISGGLPHNLEFMSVKALQLQSNNLTGSVPRLPRSIVTFDLSNNSLSGELPSNFGGPNLRVAVLFSNRITGIIPDSICQWPQLQILDLSNNLLTRGLPDCGREKLKQHYASINNSSRINSAIPYGFKIHTLLLKNNNLSGGFPVFLKQGKKLKFLDLTQNRFSGKLPAWISENMPTLVILRLRSNNFSGQIPIETMQLFSLHILDLANNTFSGVIPQSLKNLKALTTTVVGSDGIDYPFTEEYQFDDIVYDTDMLNDDSFSLVIKGQVLDYTGNALLVTSIDLSCNRLAGSIPKEIASLLGLVNLNLSWNFLSGNIPDMIGNLQALEALDLSNNQLYGEIPWCLSNLTSLSYMNVSYNNLSGRIPSGNQLDILRADDPASIYIGNPGLCGHPLPKLCPGDEPTQDCSSCHEDDNTQMDFHLGLTVGFIVGVWIIFCSLLFKKAWRYTYFSLFDKVYDKVW

HMMPanther: PTHR26393
7-970 PTHR26393,FAMILY NOT NAMED

FLLAPSTTIAASSLSSVAKKFNGSCITAEKEALLSFKAGITSDPSGRLRSWRGQDCCRWHGVRCSTRTGHIVKLDLHNDFFKEDVSSEDQEDLLSSENHVVRWLRGKISSSLLQLRRLKHLDLSGNMLGGDMAPIPEFMGSLKSLTHLNLSNMKFFGRVPPQLGNLTRLVYLDIHTDYFHFFAYSPDVSWLENLHSLEHLDMGYVNLSAAVNWIHSVNTLPNLRVLHLSFCGLSSSIPSLQHHNLTVLERLDLSLNPFNTPVAPNWYWDVTSLKSLSIGACELSGPFPDELGNLTMLETLEMGNKNINGMIPSTLKNMCNLRMIDLIGVNVGGDITDLIERLPNCSWNTLQELLLEETNITGTTLKSLLNLTALSILGIGYNDLRGSVPVEIGTLKNLTKLYVASSSLSGVISEDHFSSLTNLKEIYLSQTYLQVIVGSHWEPPFNLHKAYFSSVHLGPQVPNWLRWQSSISELDISDTGLTGRIPNWFWTTFSNARHLDLSYNQISGGLPHNLEFMSVKALQLQSNNLTGSVPRLPRSIVTFDLSNNSLSGELPSNFGGPNLRVAVLFSNRITGIIPDSICQWPQLQILDLSNNLLTRGLPDCGREKLKQHYASINNSSRINSAIPYGFKIHTLLLKNNNLSGGFPVFLKQGKKLKFLDLTQNRFSGKLPAWISENMPTLVILRLRSNNFSGQIPIETMQLFSLHILDLANNTFSGVIPQSLKNLKALTTTVVGSDGIDYPFTEEYQFDDIVYDTDMLNDDSFSLVIKGQVLDYTGNALLVTSIDLSCNRLAGSIPKEIASLLGLVNLNLSWNFLSGNIPDMIGNLQALEALDLSNNQLYGEIPWCLSNLTSLSYMNVSYNNLSGRIPSGNQLDILRADDPASIYIGNPGLCGHPLPKLCPGDEPTQDCSSCHEDDNTQMDFHLGLTVGFIVGVWIIFCSLLFKKAWRYTYFSLFDKVYDKVW

superfamily: SSF52058
29-350 SSF52058,LRR

GSCITAEKEALLSFKAGITSDPSGRLRSWRGQDCCRWHGVRCSTRTGHIVKLDLHNDFFKEDVSSEDQEDLLSSENHVVRWLRGKISSSLLQLRRLKHLDLSGNMLGGDMAPIPEFMGSLKSLTHLNLSNMKFFGRVPPQLGNLTRLVYLDIHTDYFHFFAYSPDVSWLENLHSLEHLDMGYVNLSAAVNWIHSVNTLPNLRVLHLSFCGLSSSIPSLQHHNLTVLERLDLSLNPFNTPVAPNWYWDVTSLKSLSIGACELSGPFPDELGNLTMLETLEMGNKNINGMIPSTLKNMCNLRMIDLIGVNVGGDITDLIERLPN

Gene3D: G3DSA:3.80.10.10
31-348 G3DSA:3.80.10.10

CITAEKEALLSFKAGITSDPSGRLRSWRGQDCCRWHGVRCSTRTGHIVKLDLHNDFFKEDVSSEDQEDLLSSENHVVRWLRGKISSSLLQLRRLKHLDLSGNMLGGDMAPIPEFMGSLKSLTHLNLSNMKFFGRVPPQLGNLTRLVYLDIHTDYFHFFAYSPDVSWLENLHSLEHLDMGYVNLSAAVNWIHSVNTLPNLRVLHLSFCGLSSSIPSLQHHNLTVLERLDLSLNPFNTPVAPNWYWDVTSLKSLSIGACELSGPFPDELGNLTMLETLEMGNKNINGMIPSTLKNMCNLRMIDLIGVNVGGDITDLIERL

HMMPfam: PF08263
IPR013210
35-71 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EKEALLSFKAGITSDPSGRLRSWRGQDCCRWHGVRCS

HMMPfam: PF00560
IPR001611
123-144 LRR_1
Leucine-rich repeat

RLKHLDLSGNMLGGDMAPIPEF

HMMPfam: PF00560
IPR001611
228-248 LRR_1
Leucine-rich repeat

NLRVLHLSFCGLSSSIPSLQH

superfamily: SSF52058
345-513 SSF52058,LRR

IERLPNCSWNTLQELLLEETNITGTTLKSLLNLTALSILGIGYNDLRGSVPVEIGTLKNLTKLYVASSSLSGVISEDHFSSLTNLKEIYLSQTYLQVIVGSHWEPPFNLHKAYFSSVHLGPQVPNWLRWQSSISELDISDTGLTGRIPNWFWTTFSNARHLDLSYNQIS

Gene3D: G3DSA:3.80.10.10
349-432 G3DSA:3.80.10.10

PNCSWNTLQELLLEETNITGTTLKSLLNLTALSILGIGYNDLRGSVPVEIGTLKNLTKLYVASSSLSGVISEDHFSSLTNLKEI

Gene3D: G3DSA:3.80.10.10
433-610 G3DSA:3.80.10.10

YLSQTYLQVIVGSHWEPPFNLHKAYFSSVHLGPQVPNWLRWQSSISELDISDTGLTGRIPNWFWTTFSNARHLDLSYNQISGGLPHNLEFMSVKALQLQSNNLTGSVPRLPRSIVTFDLSNNSLSGELPSNFGGPNLRVAVLFSNRITGIIPDSICQWPQLQILDLSNNLLTRGLPDC

superfamily: SSF52058
462-887 SSF52058,LRR

HLGPQVPNWLRWQSSISELDISDTGLTGRIPNWFWTTFSNARHLDLSYNQISGGLPHNLEFMSVKALQLQSNNLTGSVPRLPRSIVTFDLSNNSLSGELPSNFGGPNLRVAVLFSNRITGIIPDSICQWPQLQILDLSNNLLTRGLPDCGREKLKQHYASINNSSRINSAIPYGFKIHTLLLKNNNLSGGFPVFLKQGKKLKFLDLTQNRFSGKLPAWISENMPTLVILRLRSNNFSGQIPIETMQLFSLHILDLANNTFSGVIPQSLKNLKALTTTVVGSDGIDYPFTEEYQFDDIVYDTDMLNDDSFSLVIKGQVLDYTGNALLVTSIDLSCNRLAGSIPKEIASLLGLVNLNLSWNFLSGNIPDMIGNLQALEALDLSNNQLYGEIPWCLSNLTSLSYMNVSYNNLSGRIPSGNQLDILRADD

HMMPfam: PF00560
IPR001611
503-521 LRR_1
Leucine-rich repeat

RHLDLSYNQISGGLPHNLE

HMMPfam: PF00560
IPR001611
547-565 LRR_1
Leucine-rich repeat

VTFDLSNNSLSGELPSNFG

HMMPfam: PF00560
IPR001611
592-609 LRR_1
Leucine-rich repeat

QLQILDLSNNLLTRGLPD

Gene3D: G3DSA:3.80.10.10
627-737 G3DSA:3.80.10.10

RINSAIPYGFKIHTLLLKNNNLSGGFPVFLKQGKKLKFLDLTQNRFSGKLPAWISENMPTLVILRLRSNNFSGQIPIETMQLFSLHILDLANNTFSGVIPQSLKNLKALTT

HMMPfam: PF00560
IPR001611
710-732 LRR_1
Leucine-rich repeat

SLHILDLANNTFSGVIPQSLKNL

Gene3D: G3DSA:3.80.10.10
791-902 G3DSA:3.80.10.10

IDLSCNRLAGSIPKEIASLLGLVNLNLSWNFLSGNIPDMIGNLQALEALDLSNNQLYGEIPWCLSNLTSLSYMNVSYNNLSGRIPSGNQLDILRADDPASIYIGNPGLCGHP

HMMPfam: PF13855
812-870 LRR_8,Leucine rich repeat

LVNLNLSWNFLSGNIPDMIGNLQALEALDLSNNQLYGEIPWCLSNLTSLSYMNVSYNNL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox