PRGDB00047203 (CTV.4)

From PRG Wiki
Jump to: navigation, search
CTV.4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 160693209 (EU254171)
Gene Class Unknown
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR
Gene Species Fortunella margarita

Comment?

Fortunella margarita cultivar Nagami Kumquat NBS-LRR type disease resistance protein (CTV.4) gene, partial cds.

DNA Sequence

GGTTCCTACATGCCCTCATCTCCTTACCTTATTTCTTAACAATGACGACCTTAACAATGACGACCTCTTACGGATAATCAACAGGAGAATCAACAGTGACTTCTTGCAGTCTATGCCTAGTCTCAAAGTTTTAAACCTCTCACGTTACATGGGATTATGGGTCTTACCTTTGGGGATTTCAAAGTTGGTTTCACTTGAACACCTCGATCTTTCCTCCTCAGATATACATGAGATTCCTGAAGAGTTAAAGGCGTTGGTAAATCTTAAATGTTTGAATTTGGAAAACACAGGTTTTTTATCTAAAATTCCTCTGCAACTAATATCTAATTTTTCAAGGTTACATGTGCTGAGAATGTTCGGTAGTGGTTATTTTTCCTGCAGCAGCTCTCGAGGAGAAAGCGTTTTATTTGGTGGGGGAGAACTCCTAGTAGAGGAGTTGCTTGGTTTGAAACATCTAGAGGTATTGAGCTTGACCTTGGGAAGTTCTCGTGCCCTCCAAAGTTTTTTGACCTCACATAAGTTACGAAGTTGTACTCAAGCTATGCTCCTCCAAGTCTTTGAAGGTTCGACTCCGGTTGATGTTTCAGGCTTGGCAGATCTGAAGCGGCTCAAAAGATTACGGATTTCAGACTGTTATGAATTGGTAGAATTGAAGATTGATTATGCAGGGGAAGTACAACGTTATGGTTTCCACAGCCTTCAGAGTTTTGAAGTAAACTTTTGCTCTAAATTGAAGGACTTGACACTCCTTGTTTTCATTCCAAACCTCAAGTCCATTGCAGTAACAGATTGCGAGGCTATGGAAGAAATCATAAGTGTGGGAGAATTTGCTGGAAATCCAAA


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [Fortunella margarita].

VPTCPHLLTLFLNNDDLNNDDLLRIINRRINSDFLQSMPSLKVLNLSRYMGLWVLPLGISKLVSLEHLDLSSSDIHEIPEELKALVNLKCLNLENTGFLSKIPLQLISNFSRLHVLRMFGSGYFSCSSSRGESVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLTSHKLRSCTQAMLLQVFEGSTPVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVFIPNLKSIAVTDCEAMEEIISVGEFAGNP

Domains

Domain Start-End Description Sequence

superfamily: SSF52047
4-278 SSF52047,LRR

CPHLLTLFLNNDDLNNDDLLRIINRRINSDFLQSMPSLKVLNLSRYMGLWVLPLGISKLVSLEHLDLSSSDIHEIPEELKALVNLKCLNLENTGFLSKIPLQLISNFSRLHVLRMFGSGYFSCSSSRGESVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLTSHKLRSCTQAMLLQVFEGSTPVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVFIPNLKSIAVTDCEAMEEIISVGEFAG

HMMPanther: PTHR23155:SF108
4-272 PTHR23155:SF108,SUBFAMILY NOT NAMED

CPHLLTLFLNNDDLNNDDLLRIINRRINSDFLQSMPSLKVLNLSRYMGLWVLPLGISKLVSLEHLDLSSSDIHEIPEELKALVNLKCLNLENTGFLSKIPLQLISNFSRLHVLRMFGSGYFSCSSSRGESVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLTSHKLRSCTQAMLLQVFEGSTPVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVFIPNLKSIAVTDCEAMEEIIS

HMMPanther: PTHR23155
4-272 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CPHLLTLFLNNDDLNNDDLLRIINRRINSDFLQSMPSLKVLNLSRYMGLWVLPLGISKLVSLEHLDLSSSDIHEIPEELKALVNLKCLNLENTGFLSKIPLQLISNFSRLHVLRMFGSGYFSCSSSRGESVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLTSHKLRSCTQAMLLQVFEGSTPVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVFIPNLKSIAVTDCEAMEEIIS

Gene3D: G3DSA:3.80.10.10
29-118 G3DSA:3.80.10.10

RINSDFLQSMPSLKVLNLSRYMGLWVLPLGISKLVSLEHLDLSSSDIHEIPEELKALVNLKCLNLENTGFLSKIPLQLISNFSRLHVLRM

HMMPfam: PF12799
64-102 LRR_4,Leucine Rich repeats (2 copies)

SLEHLDLSSSDIHEIPEELKALVNLKCLNLENTGFLSKI

Gene3D: G3DSA:3.80.10.10
146-270 G3DSA:3.80.10.10

LLGLKHLEVLSLTLGSSRALQSFLTSHKLRSCTQAMLLQVFEGSTPVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVFIPNLKSIAVTDCEAMEEI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox