PRGDB00047212 (CTV.4)

From PRG Wiki
Jump to: navigation, search
CTV.4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 160693191 (EU254162)
Gene Class Unknown
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR
Gene Species Citrus nobilis

Comment?

Citrus nobilis cultivar King tangor NBS-LRR type disease resistance protein (CTV.4) gene, partial cds.

DNA Sequence

GGTTCCTACATGCCCTCATCTCCTTACCTTATTTCTTAACAATGACGGCCTCTTACGGATAATCAACAGTGACTTCTTGCAGTCTATGCCTAGTCTCAAAGTTTTAAACCTCTCACGTTACATGGGATTATTGGAATTACCTTCGGGGATTTCAAAGTTGGTTTCACTTGAACACCTTGATCTTTCCACCTCACTTATATCTGAGATTCCTGAAGAGTTAAAGGCGTTGGTAAATCTTAAATGTCTGAATTTGGAAAACACTGGTCTTTTATTAAAAATTCCTCTGCAACTAATATCTCATTTTTCAAGGTTACATGTGCTGAGAATGTTCGGTAATGGTTATTTTTCGTGCGGCCTTTATCCAGAAGACAGCGTTTTATTCGGTGGGGGAGAACTCTTAGTAGAGGAGTTGCTTGGTCTGAAACATCTAGAGGTATTGAGCTTGACCTTGGGAAGTTCTCGTGCCCTCCAAAGTTTTTTGAACTCACATATGCTACGAAGTTGTACTCGAGCTATGCTCCTCCAAGACTTCAAAGGTTCGACTATGGTTGATGTTTCTGGCTTGGCAAATCTGAAGCAGCTAAAAAGATTACGGATTTCAGACTGTTATGAATTGGTAGAATTGAAGATTGATTATGCAGGGGAAGTACAACATTTTGGTTTCCACAGCCTTCAGAGTTTTGAAGTAAACTTTTGCTCTAAATTGAAGGACTTGACACTCCTTGTTTTGATTCCAAACCTCAAGTACATTGCAGTAACAGATTGCAAGGCTATGGAAGAAATCATAAGTGTGGGAGAATTTGCTGGAAATCCAAA


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [Citrus nobilis].

VPTCPHLLTLFLNNDGLLRIINSDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGLLLKIPLQLISHFSRLHVLRMFGNGYFSCGLYPEDSVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLNSHMLRSCTRAMLLQDFKGSTMVDVSGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVNFCSKLKDLTLLVLIPNLKYIAVTDCKAMEEIISVGEFAGNP

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
3-260 L domain-like,LRR

TCPHLLTLFLNNDGLLRIINSDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGLLLKIPLQLISHFSRLHVLRMFGNGYFSCGLYPEDSVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLNSHMLRSCTRAMLLQDFKGSTMVDVSGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVNFCSKLKDLTLLVLIPNLKYIAVTDCKAMEE

HMMPanther: PTHR23155
4-263 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CPHLLTLFLNNDGLLRIINSDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGLLLKIPLQLISHFSRLHVLRMFGNGYFSCGLYPEDSVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLNSHMLRSCTRAMLLQDFKGSTMVDVSGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVNFCSKLKDLTLLVLIPNLKYIAVTDCKAMEEIIS

HMMPanther: PTHR23155:SF108
4-263 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

CPHLLTLFLNNDGLLRIINSDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGLLLKIPLQLISHFSRLHVLRMFGNGYFSCGLYPEDSVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLNSHMLRSCTRAMLLQDFKGSTMVDVSGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVNFCSKLKDLTLLVLIPNLKYIAVTDCKAMEEIIS

Seg: seg
7-18 seg

LLTLFLNNDGLL

Seg: seg
125-148 seg

VLFGGGELLVEELLGLKHLEVLSL

Gene3D: G3DSA:3.80.10.10
178-256 no description

KGSTMVDVSGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVNFCSKLKDLTLLVLIPNLKYIAVTDCK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox