PRGDB00047218 (CTV.4)

From PRG Wiki
Jump to: navigation, search
CTV.4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 160693179 (EU254156)
Gene Class Unknown
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR
Gene Species Citrus nippokoreana

Comment?

Citrus nippokoreana cultivar Korai mandarin haplotype 1 NBS-LRR type disease resistance protein (CTV.4) gene, partial cds.

DNA Sequence

GGTTCCTACATGCCCTCATCTCCTTACTTTATTTCTCAACAATAACGAACTCTTACTTAGAATCAACACTGACTTCTTGCAGTCTATGCCTAGTCTCAAAGTTTTAAACCTCTCACGTTACATGGGATTATTGGAATTACCTTCGGGGATTTCAAAGTTGGTTTCACTTGAACACCTTGATCTTTCCACCACACTTATATGTGAGATTCCTGAAGATTTAAAGGCGTTGGTAAATCTTAAATGTTTGAATTTGGAAAACGCATGTTTTTTATTTAAAATTCCTCTGCAACTAATATCTAATTTTTCGAGGTTACATGTGCTGAGAATGTTCGGTACTGGTTATTTTTCCTGCGGCCTTTATCCAGAAGACAGCGTTTTATTTGGTGGGGGAGAACTCTTAGTAAAGGAGTTGCTTGATTTGAAACATCTAGAGGTATTAAGGTTGACCTTGGGAAGTTCTCGTGCCCTCCAAAGTTTTTTGACCTCACATATGCTACGAAGTTGTACTCAAGCTTTGCTCCTCCAAGACTTCAAAGGTTCGACCTCGGTTGATGTTCCTGGCTTGGCAAATCTGAAGCAGCTAAAAAGATTACGGATTTCAGACTGTTATGAATTGGTAGAATTGAAGATTGATTATGCAGGGGAAGTACAACATTTTGGTTTCCACAGCCTTCAGAGTTTTGAAGTAAGCTTTTGCTCTGAATTGAAGGACTTGACACTCCTTGTTTTGATTCCAAACCTCAAGTCCATTGCAGTAACAGATTGCGAGGCTATGGAAGAAATCATTAGTGTGGGAGAATTTGCTGGAAATCCAAA


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [Citrus nippokoreana].

VPTCPHLLTLFLNNNELLLRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLICEIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLKHLEVLRLTLGSSRALQSFLTSHMLRSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCEAMEEIISVGEFAGNP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
4-263 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

CPHLLTLFLNNNELLLRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLICEIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLKHLEVLRLTLGSSRALQSFLTSHMLRSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCEAMEEIIS

superfamily: SSF52058
4-262 L domain-like,LRR

CPHLLTLFLNNNELLLRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLICEIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLKHLEVLRLTLGSSRALQSFLTSHMLRSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCEAMEEII

HMMPanther: PTHR23155
4-263 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CPHLLTLFLNNNELLLRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLICEIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLKHLEVLRLTLGSSRALQSFLTSHMLRSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAVTDCEAMEEIIS

HMMPfam: PF13855
5-64 LRR_8,Leucine rich repeat

PHLLTLFLNNNELLLRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTT

Seg: seg
7-19 seg

LLTLFLNNNELLL

Seg: seg
125-148 seg

VLFGGGELLVKELLDLKHLEVLRL

Gene3D: G3DSA:3.80.10.10
158-252 no description

SFLTSHMLRSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQHFGFHSLQSFEVSFCSELKDLTLLVLIPNLKSIAV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox