PRGDB00047219 (CTV.4)

From PRG Wiki
Jump to: navigation, search
CTV.4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 160693177 (EU254155)
Gene Class Unknown
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR
Gene Species Citrus reticulata

Comment?

Citrus reticulata cultivar Encore mandarin NBS-LRR type disease resistance protein (CTV.4) gene, partial cds.

DNA Sequence

GCTTCCTACATGCCCTCATCTCCTTACTTTATTTCTCAACAATAACGAACTCTTACGGAGAATCAACAGTGACTTCTTGCAGTCTATGCCTAGTCTCAAAGTTTTAAACCTCTCACATTACATGGGATTATGGGTCTTACCTTTGGGAATTTCAAAGTTGGTTTCACTTGAACACCTTGATCTTTCCACCTCACTTATATCTGAGATTCCTGAAGAGTTAAAGGCGTTGGTAAATCTTAAATGTCTGAATTTGGAAAACACTGGTCGTTTATTAAAAATTCCTCTGCAACTACTATCTAATTTTTCAAGGTTACATGTGCTGAGAATGTTCGGTAATGGTTATTTTTCGTGTGGCGATTATCCAATAGAAAGTGTTTTGTTCGGTGGGGGAGAACTCTTAGTAGAGGAGTTGCTTGGTCTGAAACATCTAGAGGTATTGAGCTTGACCTTGGGAAGTTCTCGTGCCCTCCAAAGTTTTTTGAACTCACATAAGTTACGAAGTTGTACTCAAGCTATGCTCCTCCAAGACTTCGAAGGTTCGACTTCGGTTGATGTTCCTGGCTTGGCAAATCTGAAGCAGCTAAAAAGATTACGGATTTCAGACTATTATGAATTGGTGGAATTGAAGATTGATTATGCAGGGGAAGTACAACGTTATGGTTTCCACAGCCTTCAGAGTTTTGAAGTAAACTTTTGCTCTCAAGTGAAGGACTTGACACTCCTTGTTTTGATTCCAAACCTCAAGTTCATTGAAGTAACAGATTGCGCGGCTATGGAAGAAATCACAAGTGTGGGAGAATTTGCTGGAAATCCAAA


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [Citrus reticulata].

LPTCPHLLTLFLNNNELLRRINSDFLQSMPSLKVLNLSHYMGLWVLPLGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGRLLKIPLQLLSNFSRLHVLRMFGNGYFSCGDYPIESVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVPGLANLKQLKRLRISDYYELVELKIDYAGEVQRYGFHSLQSFEVNFCSQVKDLTLLVLIPNLKFIEVTDCAAMEEITSVGEFAGNP

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-262 SSF52058,LRR

LPTCPHLLTLFLNNNELLRRINSDFLQSMPSLKVLNLSHYMGLWVLPLGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGRLLKIPLQLLSNFSRLHVLRMFGNGYFSCGDYPIESVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVPGLANLKQLKRLRISDYYELVELKIDYAGEVQRYGFHSLQSFEVNFCSQVKDLTLLVLIPNLKFIEVTDCAAMEEIT

Gene3D: G3DSA:3.80.10.10
3-112 G3DSA:3.80.10.10

TCPHLLTLFLNNNELLRRINSDFLQSMPSLKVLNLSHYMGLWVLPLGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGRLLKIPLQLLSNFSRLHVLRMFGN

HMMPanther: PTHR23155
4-261 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CPHLLTLFLNNNELLRRINSDFLQSMPSLKVLNLSHYMGLWVLPLGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGRLLKIPLQLLSNFSRLHVLRMFGNGYFSCGDYPIESVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVPGLANLKQLKRLRISDYYELVELKIDYAGEVQRYGFHSLQSFEVNFCSQVKDLTLLVLIPNLKFIEVTDCAAMEEI

HMMPanther: PTHR23155:SF108
4-261 PTHR23155:SF108,SUBFAMILY NOT NAMED

CPHLLTLFLNNNELLRRINSDFLQSMPSLKVLNLSHYMGLWVLPLGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGRLLKIPLQLLSNFSRLHVLRMFGNGYFSCGDYPIESVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVPGLANLKQLKRLRISDYYELVELKIDYAGEVQRYGFHSLQSFEVNFCSQVKDLTLLVLIPNLKFIEVTDCAAMEEI

Gene3D: G3DSA:3.80.10.10
141-256 G3DSA:3.80.10.10

KHLEVLSLTLGSSRALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVPGLANLKQLKRLRISDYYELVELKIDYAGEVQRYGFHSLQSFEVNFCSQVKDLTLLVLIPNLKFIEVTDCA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox