PRGDB00047221 (CTV.4)

From PRG Wiki
Jump to: navigation, search
CTV.4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 160693173 (EU254153)
Gene Class Unknown
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR
Gene Species Citrus reticulata

Comment?

Citrus reticulata cultivar Tien Chieh mandarin NBS-LRR type disease resistance protein (CTV.4) gene, partial cds.

DNA Sequence

GGTTCCTACATGCCCTCATCTCCTTACTTTATTTCTCAACAATAACGAACTCTTACGGAGAATCAACAGTGACTTCTTGCAGTCTATGCCTAGTCTCAAAGTTTTAAACCTCTCACATTACATGGGATTATGGGTCTTACCTTTGGGAATTTCAAAGTTGGTTTCACTTGAACACCTTGATCTTTCCACCTCACTTATATCTGAGATTCCTGAAGAGTTAAAGGCGTTGGTAAATCTTAAATGTCTGAATTTGGAAAACACTGGTCGTTTATTAAAAATTCCTCTGCAACTACTATCTAATTTTTCAAGGTTACATGTGCTGAGAATGTTCGGTAATGGTTATTTTTCGTGTGGCGATTATCCAATAGAAAGTGTTTTGTTCGGTGGGGGAGAACTCTTAGTAGAGGAGTTGCTTGGTCTGAAACATCTAGAGGTATTGAGCTTGACCTTGGGAAGTTCTCGTGCCCTCCAAAGTTTTTTGAACTCACATAAGTTACGAAGTTGTACTCAAGCTATGCTCCTCCAAGACTTCGAAGGTTCGACTTCGGTTGATGTTCCTGGCTTGGCAAATCTGAAGCAGCTAAAAAGATTACGGATTTCAGACTATTATGAATTGGTGGAATTGAAGATTGATTATGCAGGGGAAGTACAACGTTATGGTTTCCACAGCCTTCAGAGTTTTGAAGTAAACTTTTGCTCTCAAGTGAAGGACTTGACACTCCTTGTTTTGATTCCAAACCTCAAGTTCATTGAAGTAACAGATTGCGCGGCTATGGAAGAAATCACAAGTGTGGGAGAATTTGCTGGAAATCCAAA


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [Citrus reticulata].

VPTCPHLLTLFLNNNELLRRINSDFLQSMPSLKVLNLSHYMGLWVLPLGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGRLLKIPLQLLSNFSRLHVLRMFGNGYFSCGDYPIESVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVPGLANLKQLKRLRISDYYELVELKIDYAGEVQRYGFHSLQSFEVNFCSQVKDLTLLVLIPNLKFIEVTDCAAMEEITSVGEFAGNP

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-262 L domain-like,LRR

VPTCPHLLTLFLNNNELLRRINSDFLQSMPSLKVLNLSHYMGLWVLPLGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGRLLKIPLQLLSNFSRLHVLRMFGNGYFSCGDYPIESVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVPGLANLKQLKRLRISDYYELVELKIDYAGEVQRYGFHSLQSFEVNFCSQVKDLTLLVLIPNLKFIEVTDCAAMEEIT

HMMPanther: PTHR23155
4-261 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CPHLLTLFLNNNELLRRINSDFLQSMPSLKVLNLSHYMGLWVLPLGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGRLLKIPLQLLSNFSRLHVLRMFGNGYFSCGDYPIESVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVPGLANLKQLKRLRISDYYELVELKIDYAGEVQRYGFHSLQSFEVNFCSQVKDLTLLVLIPNLKFIEVTDCAAMEEI

HMMPanther: PTHR23155:SF108
4-261 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

CPHLLTLFLNNNELLRRINSDFLQSMPSLKVLNLSHYMGLWVLPLGISKLVSLEHLDLSTSLISEIPEELKALVNLKCLNLENTGRLLKIPLQLLSNFSRLHVLRMFGNGYFSCGDYPIESVLFGGGELLVEELLGLKHLEVLSLTLGSSRALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVPGLANLKQLKRLRISDYYELVELKIDYAGEVQRYGFHSLQSFEVNFCSQVKDLTLLVLIPNLKFIEVTDCAAMEEI

Seg: seg
7-18 seg

LLTLFLNNNELL

Seg: seg
125-148 seg

VLFGGGELLVEELLGLKHLEVLSL

Gene3D: G3DSA:3.80.10.10
178-201 no description

EGSTSVDVPGLANLKQLKRLRISD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox