PRGDB00047224 (CTV.4)

From PRG Wiki
Jump to: navigation, search
CTV.4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 160693167 (EU254150)
Gene Class RLP
Domain Type LRR, LRR, LRR, LRR, Ser-Thr Kinase
Gene Species Citrus limon

Comment?

Citrus limon cultivar Frost eureka lemon NBS-LRR type disease resistance protein (CTV.4) gene, partial cds.

DNA Sequence

GGTTCCTACATGCCCTCATCTCCTTACCTTATTTCTTAACAATGACGACGTCTTACGGATAATCAACAGTGACTTCTTGCAGTCTATGCCTAGTCTCAAAGTTTTAAACCTCTCACGTTACATGGGAGTATGGGTCTTACCTTTGGGGATTTCAAAGTTGGTTTCACTTGAACTCCTCGATCTTTCCTCCTCAGCTATACATGAGATTCCTGAAGAGTTAAAGGCGTTGGTAAATCTTAAATGTTTGAATTTGGAAAACACAGGTTTTTTATTTAAAATTCCTCTGCAACTAATATCTAATTTTTCGTGGTTACATGTGCTGAGAATGTTCGGTACTGGTTATTTTTCCTGCGGCCTTTATCCAGAAGACAGCGTTTTATTTGGTGGGGGAGAACTCTTAGTAAAGGAGTTGCTTGGTTTGAAACATCTAGAGGTATTGAGCTTGACCTTGGGAAGTTCTCGTGCCCTCCAAAGTTTTTTGACCTCACATAAGTTACGAAGTTGTACTCAAGCTATGCTCCTCCAAGACTTTGAAGGTTCGACTCCGGTTGATGTTTCAGGCTTGGCAGATCTGAAGCGGCTCAAAAGATTACGGATTTCAGACTGTTATGAATTGGTAGAATTGAAGATTGATTATGCAGGGGAAGTACAACGTCATGGTTTCCACAGCCTTCAGAGTTTTGAAGTAAACTTTTGCTCTAAATTGAAGGACTTGACACTCCTTGTTTTCATTCCAAACCTCAAGTCCATTGCAGTAACAGATTGCGAGGCTATGGAAGAAATCATAAGTGTGGGAGAATTTGCTGGAAATCCAAA


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [Citrus limon].

VPTCPHLLTLFLNNDDVLRIINSDFLQSMPSLKVLNLSRYMGVWVLPLGISKLVSLELLDLSSSAIHEIPEELKALVNLKCLNLENTGFLFKIPLQLISNFSWLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLGLKHLEVLSLTLGSSRALQSFLTSHKLRSCTQAMLLQDFEGSTPVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRHGFHSLQSFEVNFCSKLKDLTLLVFIPNLKSIAVTDCEAMEEIISVGEFAGNP

Domains

Domain Start-End Description Sequence

superfamily: SSF52047
4-269 RNI-like,LRR

CPHLLTLFLNNDDVLRIINSDFLQSMPSLKVLNLSRYMGVWVLPLGISKLVSLELLDLSSSAIHEIPEELKALVNLKCLNLENTGFLFKIPLQLISNFSWLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLGLKHLEVLSLTLGSSRALQSFLTSHKLRSCTQAMLLQDFEGSTPVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRHGFHSLQSFEVNFCSKLKDLTLLVFIPNLKSIAVTDCEAMEEIISVGEFAG

HMMPanther: PTHR23155
4-263 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CPHLLTLFLNNDDVLRIINSDFLQSMPSLKVLNLSRYMGVWVLPLGISKLVSLELLDLSSSAIHEIPEELKALVNLKCLNLENTGFLFKIPLQLISNFSWLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLGLKHLEVLSLTLGSSRALQSFLTSHKLRSCTQAMLLQDFEGSTPVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRHGFHSLQSFEVNFCSKLKDLTLLVFIPNLKSIAVTDCEAMEEIIS

HMMPanther: PTHR23155:SF108
4-263 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

CPHLLTLFLNNDDVLRIINSDFLQSMPSLKVLNLSRYMGVWVLPLGISKLVSLELLDLSSSAIHEIPEELKALVNLKCLNLENTGFLFKIPLQLISNFSWLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLGLKHLEVLSLTLGSSRALQSFLTSHKLRSCTQAMLLQDFEGSTPVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRHGFHSLQSFEVNFCSKLKDLTLLVFIPNLKSIAVTDCEAMEEIIS

Seg: seg
51-64 seg

SKLVSLELLDLSSS

Seg: seg
125-148 seg

VLFGGGELLVKELLGLKHLEVLSL

Gene3D: G3DSA:3.80.10.10
178-252 no description

EGSTPVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRHGFHSLQSFEVNFCSKLKDLTLLVFIPNLKSIAV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox